KEGG   Homo sapiens (human): 8833
Entry
8833              CDS       T01001                                 

Gene name
GMPS, GATD7
Definition
(RefSeq) guanine monophosphate synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    8833 (GMPS)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    8833 (GMPS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    8833 (GMPS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     8833 (GMPS)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   8833 (GMPS)
SSDB
Motif
Pfam: GATase GMP_synt_C NAD_synthase Peptidase_C26 QueC tRNA_Me_trans ATP_bind_3 Asn_synthase PAPS_reduct ThiI Arginosuc_synth Pyr_redox_2
Other DBs
NCBI-GeneID: 8833
NCBI-ProteinID: NP_003866
OMIM: 600358
HGNC: 4378
Ensembl: ENSG00000163655
Vega: OTTHUMG00000158551
Pharos: P49915(Tbio)
UniProt: P49915 A0A140VJK6
Structure
PDB: 
2VPI 2VXO

Position
3q25.31
AA seq 693 aa
MALCNGDSKLENAGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETP
AFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHK
KSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANE
SKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTVQNRELECIREIKERVGTSKVL
VLLSGGVDSTVCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA
HSFYNGTTTLPISDEDRTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANEVIGEMNLKPE
EVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVR
ILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPH
TLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDW
ESLIFLARLIPRMCHNVNRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILR
ESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGIPATPGNEIPVE
VVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggctctgtgcaacggagactccaagctggagaatgctggaggagaccttaaggatggc
caccaccactatgaaggagctgttgtcattctggatgctggtgctcagtacgggaaagtc
atagaccgaagagtgagggaactgttcgtgcagtctgaaattttccccttggaaacacca
gcatttgctataaaggaacaaggattccgtgctattatcatctctggaggacctaattct
gtgtatgctgaagatgctccctggtttgatccagcaatattcactattggcaagcctgtt
cttggaatttgctatggtatgcagatgatgaataaggtatttggaggtactgtgcacaaa
aaaagtgtcagagaagatggagttttcaacattagtgtggataatacatgttcattattc
aggggccttcagaaggaagaagttgttttgcttacacatggagatagtgtagacaaagta
gctgatggattcaaggttgtggcacgttctggaaacatagtagcaggcatagcaaatgaa
tctaaaaagttatatggagcacagttccaccctgaagttggccttacagaaaatggaaaa
gtaatactgaagaatttcctttatgatatagctggatgcagtggaaccttcaccgtgcag
aacagagaacttgagtgtattcgagagatcaaagagagagtaggcacgtcaaaagttttg
gttttactcagtggtggagtagactcaacagtttgtacagctttgctaaatcgtgctttg
aaccaagaacaagtcattgctgtgcacattgataatggctttatgagaaaacgagaaagc
cagtctgttgaagaggccctcaaaaagcttggaattcaggtcaaagtgataaatgctgct
cattctttctacaatggaacaacaaccctaccaatatcagatgaagatagaaccccacgg
aaaagaattagcaaaacgttaaatatgaccacaagtcctgaagagaaaagaaaaatcatt
ggggatacttttgttaagattgccaatgaagtaattggagaaatgaacttgaaaccagag
gaggttttccttgcccaaggtactttacggcctgatctaattgaaagtgcatcccttgtt
gcaagtggcaaagctgaactcatcaaaacccatcacaatgacacagagctcatcagaaag
ttgagagaggagggaaaagtaatagaacctctgaaagattttcataaagatgaagtgaga
attttgggcagagaacttggacttccagaagagttagtttccaggcatccatttccaggt
cctggcctggcaatcagagtaatatgtgctgaagaaccttatatttgtaaggactttcct
gaaaccaacaatattttgaaaatagtagctgatttttctgcaagtgttaaaaagccacat
accctattacagagagtcaaagcctgcacaacagaagaggatcaggagaagctgatgcaa
attaccagtctgcattcactgaatgccttcttgctgccaattaaaactgtaggtgtgcag
ggtgactgtcgttcctacagttacgtgtgtggaatctccagtaaagatgaacctgactgg
gaatcacttatttttctggctaggcttatacctcgcatgtgtcacaacgttaacagagtt
gtttatatatttggcccaccagttaaagaacctcctacagatgttactcccactttcttg
acaacaggggtgctcagtactttacgccaagctgattttgaggcccataacattctcagg
gagtctgggtatgctgggaaaatcagccagatgccggtgattttgacaccattacatttt
gatcgggacccacttcaaaagcagccttcatgccagagatctgtggttattcgaaccttt
attactagtgacttcatgactggtatacctgcaacacctggcaatgagatccctgtagag
gtggtattaaagatggtcactgagattaagaagattcctggtatttctcgaattatgtat
gacttaacatcaaagcccccaggaactactgagtgggagtaa

DBGET integrated database retrieval system