KEGG   Homo sapiens (human): 8835Help
Entry
8835              CDS       T01001                                 

Gene name
SOCS2, CIS2, Cish2, SOCS-2, SSI-2, SSI2, STATI2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
hsa04910  Insulin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04930  Type II diabetes mellitus
Module
hsa_M00388  ECS complex
hsa_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    8835 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    8835 (SOCS2)
   04917 Prolactin signaling pathway
    8835 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    8835 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8835 (SOCS2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     8835 (SOCS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Motif
Other DBs
NCBI-GeneID: 8835
NCBI-ProteinID: NP_001257396
OMIM: 605117
HGNC: 19382
Ensembl: ENSG00000120833
Vega: OTTHUMG00000170160
Pharos: O14508(Tbio)
UniProt: O14508 A0A024RBD2
Structure
PDB: 

Position
12q22
AA seq 198 aa AA seqDB search
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcggtgccttgagccctccgggaatggcggggaagggacgcggagccagtgg
gggaccgcggggtcggcggaggagccatccccgcaggcggcgcgtctggcgaaggccctg
cgggagctcggtcagacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagctcgcattcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatcttcgaatcgaataccaa
gacggaaaattcagattggactctatcatatgtgtcaaatccaagcttaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggtcca
gaagccccccggaacggcactgttcacctttatctgaccaaaccgctctacacgtcagca
ccatctctgcagcatctctgtaggctcaccattaacaaatgtaccggtgccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

DBGET integrated database retrieval system