KEGG   Homo sapiens (human): 8841Help
Entry
8841              CDS       T01001                                 

Gene name
HDAC3, HD3, RPD3, RPD3-2
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  histone deacetylase 3 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
N00375  HPV E7 to TNF-IRF1 signaling pathway
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Mocetinostat (DG01404): D09357 D09641
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    8841 (HDAC3)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    8841 (HDAC3)
  09164 Substance dependence
   05034 Alcoholism
    8841 (HDAC3)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    8841 (HDAC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8841 (HDAC3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     8841 (HDAC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     8841 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 8841
NCBI-ProteinID: NP_003874
OMIM: 605166
HGNC: 4854
Ensembl: ENSG00000171720
Vega: OTTHUMG00000129629
Pharos: O15379(Tclin)
UniProt: O15379
Structure
PDB: 

Position
5q31.3
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcctatttctacgaccccgacgtgggcaacttccactacggagct
ggacaccctatgaagccccatcgcctggcattgacccatagcctggtcctgcattacggt
ctctataagaagatgatcgtcttcaagccataccaggcctcccaacatgacatgtgccgc
ttccactccgaggactacattgacttcctgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagtcttaatgccttcaacgtaggcgatgactgcccagtgtttcccgggctc
tttgagttctgctcgcgttacacaggcgcatctctgcaaggagcaacccagctgaacaac
aagatctgtgatattgccattaactgggctggtggtctgcaccatgccaagaagtttgag
gcctctggcttctgctatgtcaacgacattgtgattggcatcctggagctgctcaagtac
caccctcgggtgctctacattgacattgacatccaccatggtgacggggttcaagaagct
ttctacctcactgaccgggtcatgacggtgtccttccacaaatacggaaattacttcttc
cctggcacaggtgacatgtatgaagtcggggcagagagtggccgctactactgtctgaac
gtgcccctgcgggatggcattgatgaccagagttacaagcaccttttccagccggttatc
aaccaggtagtggacttctaccaacccacgtgcattgtgctccagtgtggagctgactct
ctgggctgtgatcgattgggctgctttaacctcagcatccgagggcatggggaatgcgtt
gaatatgtcaagagcttcaatatccctctactcgtgctgggtggtggtggttatactgtc
cgaaatgttgcccgctgctggacatatgagacatcgctgctggtagaagaggccattagt
gaggagcttccctatagtgaatacttcgagtactttgccccagacttcacacttcatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatctggaccagatccgccag
acaatctttgaaaacctgaagatgctgaaccatgcacctagtgtccagattcatgacgtg
cctgcagacctcctgacctatgacaggactgatgaggctgatgcagaggagaggggtcct
gaggagaactatagcaggccagaggcacccaatgagttctatgatggagaccatgacaat
gacaaggaaagcgatgtggagatttaa

DBGET integrated database retrieval system