KEGG   Homo sapiens (human): 8841Help
Entry
8841              CDS       T01001                                 

Gene name
HDAC3, HD3, RPD3, RPD3-2
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  histone deacetylase 3 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
N00375  HPV E7 to TNF-IRF1 signaling pathway
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Mocetinostat (DG01404): D09357 D09641
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tinostamustine: D11182
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    8841 (HDAC3)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    8841 (HDAC3)
  09165 Substance dependence
   05034 Alcoholism
    8841 (HDAC3)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    8841 (HDAC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8841 (HDAC3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     8841 (HDAC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     8841 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 8841
NCBI-ProteinID: NP_003874
OMIM: 605166
HGNC: 4854
Ensembl: ENSG00000171720
Vega: OTTHUMG00000129629
Pharos: O15379(Tclin)
UniProt: O15379
Structure
PDB: 

Position
5q31.3
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcctatttctacgaccccgacgtgggcaacttccactacggagct
ggacaccctatgaagccccatcgcctggcattgacccatagcctggtcctgcattacggt
ctctataagaagatgatcgtcttcaagccataccaggcctcccaacatgacatgtgccgc
ttccactccgaggactacattgacttcctgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagtcttaatgccttcaacgtaggcgatgactgcccagtgtttcccgggctc
tttgagttctgctcgcgttacacaggcgcatctctgcaaggagcaacccagctgaacaac
aagatctgtgatattgccattaactgggctggtggtctgcaccatgccaagaagtttgag
gcctctggcttctgctatgtcaacgacattgtgattggcatcctggagctgctcaagtac
caccctcgggtgctctacattgacattgacatccaccatggtgacggggttcaagaagct
ttctacctcactgaccgggtcatgacggtgtccttccacaaatacggaaattacttcttc
cctggcacaggtgacatgtatgaagtcggggcagagagtggccgctactactgtctgaac
gtgcccctgcgggatggcattgatgaccagagttacaagcaccttttccagccggttatc
aaccaggtagtggacttctaccaacccacgtgcattgtgctccagtgtggagctgactct
ctgggctgtgatcgattgggctgctttaacctcagcatccgagggcatggggaatgcgtt
gaatatgtcaagagcttcaatatccctctactcgtgctgggtggtggtggttatactgtc
cgaaatgttgcccgctgctggacatatgagacatcgctgctggtagaagaggccattagt
gaggagcttccctatagtgaatacttcgagtactttgccccagacttcacacttcatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatctggaccagatccgccag
acaatctttgaaaacctgaagatgctgaaccatgcacctagtgtccagattcatgacgtg
cctgcagacctcctgacctatgacaggactgatgaggctgatgcagaggagaggggtcct
gaggagaactatagcaggccagaggcacccaatgagttctatgatggagaccatgacaat
gacaaggaaagcgatgtggagatttaa

DBGET integrated database retrieval system