KEGG   Homo sapiens (human): 8843
Entry
8843              CDS       T01001                                 

Symbol
HCAR3, GPR109B, HCA3, HM74, PUMAG, Puma-g
Name
(RefSeq) hydroxycarboxylic acid receptor 3
  KO
K08402  hydroxycarboxylic acid receptor 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    8843 (HCAR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8843 (HCAR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Hydroxy-carboxylic acid
    8843 (HCAR3)
SSDB
Motif
Pfam: 7tm_1 CoV_NSP6
Other DBs
NCBI-GeneID: 8843
NCBI-ProteinID: NP_006009
OMIM: 606039
HGNC: 16824
Ensembl: ENSG00000255398
Vega: OTTHUMG00000166034
Pharos: P49019(Tbio)
UniProt: P49019
Position
12q24.31
AA seq 387 aa
MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWK
SSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTV
VAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISF
SICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVF
VICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPS
FPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGP
TSNNHSKKGHCHQEPASLEKQLGCCIE
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaatcggcaccatctgcaggatcactttctggaaatagacaagaagaactgctgtgtg
ttccgagatgacttcattgccaaggtgttgccgccggtgttggggctggagtttatcttt
gggcttctgggcaatggccttgccctgtggattttctgtttccacctcaagtcctggaaa
tccagccggattttcctgttcaacctggcagtagctgactttctactgatcatctgcctg
ccgttcgtgatggactactatgtgcggcgttcagactggaagtttggggacatcccttgc
cggctggtgctcttcatgtttgccatgaaccgccagggcagcatcatattcctcacggtg
gtggcggtagacaggtatttccgggtggtccatccccaccacgccctgaacaagatctcc
aattggacagcagccatcatctcttgccttctgtggggcatcactgttggcctaacagtc
cacctcctgaagaagaagttgctgatccagaatggcactgcaaatgtgtgcatcagcttc
agcatctgccataccttccggtggcacgaagctatgttcctcctggagttcttcctgccc
ctgggcatcatcctgttctgctcagccagaattatctggagcctgcggcagagacaaatg
gaccggcatgccaagatcaagagagccatcaccttcatcatggtggtggccatcgtcttt
gtcatctgcttccttcccagcgtggttgtgcggatccacatcttctggctcctgcacact
tcgggcacgcagaattgtgaagtgtaccgctcggtggacctggcgttctttatcactctc
agcttcacctacatgaacagcatgctggaccccgtggtgtactacttctccagcccatcc
tttcccaacttcttctccactttgatcaaccgctgcctccagaggaagataacaggtgag
ccagataataaccgcagcacgagcgtcgagctcacaggggaccccaacaaaaccagaggc
gctccagaggcgttaatcgccaactccggtgagccatggagcccctcttatctgggccca
acctcaaataaccattccaagaagggacattgtcaccaagaaccagcatctctggagaaa
cagttgggctgttgcatcgagtaa

DBGET integrated database retrieval system