KEGG   Homo sapiens (human): 8848
Entry
8848              CDS       T01001                                 
Symbol
TSC22D1, Ptg-2, TGFB1I4, TSC22
Name
(RefSeq) TSC22 domain family member 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TSC22 YabA K-box SOGA ZapB
Other DBs
NCBI-GeneID: 8848
NCBI-ProteinID: NP_904358
OMIM: 607715
HGNC: 16826
Ensembl: ENSG00000102804
Pharos: Q15714(Tbio)
UniProt: Q15714
Position
13:complement(44432143..44577344)
AA seq 1073 aa
MHQPPESTAAAAAAADISARKMAHPAMFPRRGSGSGSASALNAAGTGVGSNATSSEDFPP
PSLLQPPPPAASSTSGPQPPPPQSLNLLSQAQLQAQPLAPGGTQMKKKSGFQITSVTPAQ
ISASISSNNSIAEDTESYDDLDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNF
QEAETPGAVSPNQPHLPQPHLPHLPQQNVVINGNAHPHHLHHHHQIHHGHHLQHGHHHPS
HVAVASASITGGPPSSPVSRKLSTTGSSDSITPVAPTSAVSSSGSPASVMTNMRAPSTTG
GIGINSVTGTSTVNNVNITAVGSFNPNVTSSMLGNVNISTSNIPSAAGVSVGPGVTSGVN
VNILSGMGNGTISSSAAVSSVPNAAAGMTGGSVSSQQQQPTVNTSRFRVVKLDSSSEPFK
KGRWTCTEFYEKENAVPATEGVLINKVVETVKQNPIEVTSERESTSGSSVSSSVSTLSHY
TESVGSGEMGAPTVVVQQQQQQQQQQQQQPALQGVTLQQMDFGSTGPQSIPAVSIPQSIS
QSQISQVQLQSQELSYQQKQGLQPVPLQATMSAATGIQPSPVNVVGVTSALGQQPSISSL
AQPQLPYSQAAPPVQTPLPGAPPPQQLQYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQ
PILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQPVGQAPAAV
SAVPTGSQIANIGQQANIPTAVQQPSTQVPPSVIQQGAPPSSQVVPPAQTGIIHQGVQTS
APSLPQQLVIASQSSLLTVPPQPQGVEPVAQGIVSQQLPAVSSLPSASSISVTSQVSSTG
PSGMPSAPTNLVPPQNIAQTPATQNGNLVQSVSQPPLIATNTNLPLAQQIPLSSTQFSAQ
SLAQAIGSQIEDARRAAEPSLVGLPQTISGDSGGMSAVSDGSSSSLAASASLFPLKVLPL
TTPLVDGEDESSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQL
EQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgcaccagccgcctgagtccaccgccgcggccgccgccgctgcagacattagcgctagg
aagatggcgcacccggcaatgttccctcgaaggggcagcggtagtggcagcgcctctgct
ctcaatgcagcaggtaccggcgtcggtagtaatgccacatcttccgaggattttccgcct
ccgtcgctgcttcagccgccgccccctgcagcatcttctacgtcgggaccacagcctccg
cctccacaaagcctgaacctcctttcgcaggctcagctgcaggcacagcctcttgcgcca
ggcggaactcaaatgaaaaagaaaagtggcttccagataactagcgttactcctgctcag
atctccgctagtatcagctctaacaacagtatagcagaggacactgagagctatgatgat
ctggatgaatctcacacggaagatctctcttcttcggagatccttgatgtgtcactttcc
agggctactgacttaggggagcccgaacgcagctcctcagaagagaccctaaataacttc
caggaagccgagacacctggggcagtctctcccaaccagccccaccttcctcagcctcat
ttgcctcaccttccacaacagaatgttgtgatcaatgggaatgctcatccacaccacctc
catcaccaccatcagattcatcatgggcaccacctccaacatggtcaccaccatccatct
catgttgctgtggccagtgcatccattactggtgggccaccctcaagcccagtatctaga
aaactctctacaactggaagctctgacagtatcacaccagttgcaccaacttctgctgta
tcatccagtggttcacctgcatctgtaatgactaatatgcgtgctccaagtactacaggt
ggaataggtataaattctgttactggcactagtacagtaaataatgttaacattactgct
gtgggtagttttaatcctaatgtgacaagcagcatgcttggtaatgttaatataagtaca
agcaatattcctagtgctgctggtgtgagtgttgggcctggagttaccagtggtgttaat
gtgaatatcttgagtggcatgggcaatggtactatttcttcctctgctgctgttagcagt
gttcctaatgcagctgcagggatgactgggggatcggtttcaagtcagcagcaacaacca
acagttaacacttcgaggttcagagttgtgaagttagattctagttctgagccctttaaa
aaaggtagatggacttgcactgagttctatgaaaaagaaaatgctgtacctgctacagaa
ggtgtgctgataaataaagtggtggagactgtaaagcaaaatccgatagaagtgacttct
gaaagggagagcactagtgggagttcagtgagcagtagtgtcagcacactgagtcactat
acagagagtgtgggaagtggagagatgggagcccctactgtggtggtgcagcagcagcag
cagcaacaacaacaacaacagcaacaaccagctctccaaggtgtgaccctccaacagatg
gattttggtagcactggtccacagagtattccagcagttagtataccacagagtatttct
cagtcacagatctcacaagtacaattacagtctcaagaactgagctatcagcaaaagcaa
ggtcttcagccagtacctctgcaagccactatgagtgctgcaactggtatccagccatcg
cctgtaaatgtggttggtgtaacttcagctttaggtcagcagccttccatttccagtttg
gctcaaccccagctaccatattctcaggcggctcctccagtgcaaactccccttccaggg
gcaccaccaccccaacagttacagtatggacaacagcaaccaatggtttctacacagatg
gccccaggccatgtcaaatcagtgactcaaaatcctgcttcagagtatgtacaacagcag
ccaattcttcaaacagcaatgtcctccggacagcccagttctgcaggagtaggagcagga
acaacagtgattcctgtggctcagccacagggtatccagctgccagtgcagcccacagca
gtcccagcacaacctgcaggggcatctgtccagcctgttggccaggctccggcagcagtg
tctgctgtacctactggcagtcagattgcaaatattggtcagcaagcaaacatacctact
gcagtgcagcagccctctacccaggttccaccttcagttattcagcagggtgctcctcca
tcttcgcaagtggttccacctgctcaaactgggattattcatcagggagttcaaactagt
gctccaagccttcctcaacaattggttattgcatcccaaagttccttgttaactgtgcct
ccccagccacaaggagtagaaccagtagctcaaggaattgtttcacagcagttgcctgca
gttagttctttgccctctgctagtagtatttctgttacaagtcaggttagttcaactggt
ccttctggaatgccttctgccccaacaaacttggttccaccacaaaatatagcacaaacc
cctgctacccaaaatggtaatttggttcaaagtgttagtcaacctcccttgatagcaact
aatacaaatttgcctttggcacaacagataccactaagttctacccagttctccgcacaa
tcattagctcaggcaattggaagccaaattgaagatgccaggcgtgcagcggagccctcc
ttagttggcttacctcagactatcagtggtgacagtgggggaatgtcagcagtttcagat
gggagtagcagcagcctagcagcctctgcttctcttttcccgttgaaggtgctaccgctg
acgacacccctggtggatggcgaggatgagagctcctctggtgcaagtgtggtagctatt
gacaacaaaatcgagcaagctatggatctagtgaaaagccatttgatgtatgcggtcaga
gaagaagtggaggtcctcaaagagcaaatcaaagaactaatagagaaaaattcccagctg
gagcaggagaacaatctgctgaagacactggccagtcctgagcagcttgcccagtttcag
gcccagctgcagactggctccccccctgccaccacccagccacagggcaccacacagccc
cccgcccagccagcatcgcagggctcaggaccaaccgcatag

DBGET integrated database retrieval system