KEGG   Homo sapiens (human): 8850Help
Entry
8850              CDS       T01001                                 

Gene name
KAT2B, CAF, P/CAF, PCAF
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Network
N00221  HTLV-1 Tax to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    8850 (KAT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    8850 (KAT2B)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    8850 (KAT2B)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    8850 (KAT2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    8850 (KAT2B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8850 (KAT2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     8850 (KAT2B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     8850 (KAT2B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    8850 (KAT2B)
   HAT complexes
    PCAF complex
     8850 (KAT2B)
    STAGA complex
     8850 (KAT2B)
    TFTC complex
     8850 (KAT2B)
    SAGA complex
     8850 (KAT2B)
    SLIK complex
     8850 (KAT2B)
    ADA-HAT complex
     8850 (KAT2B)
    HAT-A2 complex
     8850 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 8850
NCBI-ProteinID: NP_003875
OMIM: 602303
HGNC: 8638
Ensembl: ENSG00000114166
Vega: OTTHUMG00000130481
Pharos: Q92831(Tchem)
UniProt: Q92831
Structure
PDB: 

Position
3p24.3
AA seq 832 aa AA seqDB search
MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAA
AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKE
RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
NSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSA
RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK
EPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggctggcggggccgggccgggcggctgcggggcaggagccggggcaggggcc
gggcccggggcgctgcccccgcagcctgcggcgcttccgcccgcgcccccgcagggctcc
ccctgcgccgctgccgccgggggctcgggcgcctgcggtccggcgacggcagtggctgca
gcgggcacggccgaaggaccgggaggcggtggctcggcccgaatcgccgtgaagaaagcg
caactacgctccgctccgcgggccaagaaactggagaaactcggagtgtactccgcctgc
aaggccgaggagtcttgtaaatgtaatggctggaaaaaccctaacccctcacccactccc
cccagagccgacctgcagcaaataattgtcagtctaacagaatcctgtcggagttgtagc
catgccctagctgctcatgtttcccacctggagaatgtgtcagaggaagaaatgaacaga
ctcctgggaatagtattggatgtggaatatctctttacctgtgtccacaaggaagaagat
gcagataccaaacaagtttatttctatctatttaagctcttgagaaagtctattttacaa
agaggaaaacctgtggttgaaggctctttggaaaagaaacccccatttgaaaaacctagc
attgaacagggtgtgaataactttgtgcagtacaaatttagtcacctgccagcaaaagaa
aggcaaacaatagttgagttggcaaaaatgttcctaaaccgcatcaactattggcatctg
gaggcaccatctcaacgaagactgcgatctcccaatgatgatatttctggatacaaagag
aactacacaaggtggctgtgttactgcaacgtgccacagttctgcgacagtctacctcgg
tacgaaaccacacaggtgtttgggagaacattgcttcgctcggtcttcactgttatgagg
cgacaactcctggaacaagcaagacaggaaaaagataaactgcctcttgaaaaacgaact
ctaatcctcactcatttcccaaaatttctgtccatgctagaagaagaagtatatagtcaa
aactctcccatctgggatcaggattttctctcagcctcttccagaaccagccagctaggc
atccaaacagttatcaatccacctcctgtggctgggacaatttcatacaattcaacctca
tcttcccttgagcagccaaacgcagggagcagcagtcctgcctgcaaagcctcttctgga
cttgaggcaaacccaggagaaaagaggaaaatgactgattctcatgttctggaggaggcc
aagaaaccccgagttatgggggatattccgatggaattaatcaacgaggttatgtctacc
atcacggaccctgcagcaatgcttggaccagagaccaattttctgtcagcacactcggcc
agggatgaggcggcaaggttggaagagcgcaggggtgtaattgaatttcacgtggttggc
aattccctcaaccagaaaccaaacaagaagatcctgatgtggctggttggcctacagaac
gttttctcccaccagctgccccgaatgccaaaagaatacatcacacggctcgtctttgac
ccgaaacacaaaacccttgctttaattaaagatggccgtgttattggtggtatctgtttc
cgtatgttcccatctcaaggattcacagagattgtcttctgtgctgtaacctcaaatgag
caagtcaagggctatggaacacacctgatgaatcatttgaaagaatatcacataaagcat
gacatcctgaacttcctcacatatgcagatgaatatgcaattggatactttaagaaacag
ggtttctccaaagaaattaaaatacctaaaaccaaatatgttggctatatcaaggattat
gaaggagccactttaatgggatgtgagctaaatccacggatcccgtacacagaattttct
gtcatcattaaaaagcagaaggagataattaaaaaactgattgaaagaaaacaggcacaa
attcgaaaagtttaccctggactttcatgttttaaagatggagttcgacagattcctata
gaaagcattcctggaattagagagacaggctggaaaccgagtggaaaagagaaaagtaaa
gagcccagagaccctgaccagctttacagcacgctcaagagcatcctccagcaggtgaag
agccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagctccaggatat
tatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctcaagaatagg
tactacgtgtctaagaaattattcatggcagacttacagcgagtctttaccaattgcaaa
gagtacaacccccctgagagtgaatactacaaatgtgccaatatcctggagaaattcttc
ttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system