KEGG   Homo sapiens (human): 8851
Entry
8851              CDS       T01001                                 

Symbol
CDK5R1, CDK5P35, CDK5R, NCK5A, p23, p25, p35, p35nck5a
Name
(RefSeq) cyclin dependent kinase 5 regulatory subunit 1
  KO
K11716  cyclin-dependent kinase 5 activator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05030  Cocaine addiction
Network
nt06418  Oxidative phosphorylation
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
  Element
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    8851 (CDK5R1)
   05022 Pathways of neurodegeneration - multiple diseases
    8851 (CDK5R1)
  09165 Substance dependence
   05030 Cocaine addiction
    8851 (CDK5R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8851 (CDK5R1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    8851 (CDK5R1)
SSDB
Motif
Pfam: CDK5_activator MTBP_C
Other DBs
NCBI-GeneID: 8851
NCBI-ProteinID: NP_003876
OMIM: 603460
HGNC: 1775
Ensembl: ENSG00000176749
Vega: OTTHUMG00000132814
Pharos: Q15078(Tchem)
UniProt: Q15078 Q8N619
Structure
PDB: 
3O0G 1UNG 1UNH 1H4L 1UNL

Position
17q11.2
AA seq 307 aa
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
NT seq 924 nt   +upstreamnt  +downstreamnt
atgggcacggtgctgtccctgtctcccagctaccggaaggccacgctgtttgaggatggc
gcggccaccgtgggccactatacggccgtacagaacagcaagaacgccaaggacaagaac
ctgaagcgccactccatcatctccgtgctgccttggaagagaatcgtggccgtgtcggcc
aagaagaagaactccaagaaggtgcagcccaacagcagctaccagaacaacatcacgcac
ctcaacaatgagaacctgaagaagtcgctgtcgtgcgccaacctgtccacattcgcccag
cccccaccggcccagccgcctgcacccccggccagccagctctcgggttcccagaccggg
ggctcctcctcagtcaagaaagcccctcaccctgccgtcacctccgcagggacgcccaaa
cgggtcatcgtccaggcgtccaccagtgagctgcttcgctgcctgggtgagtttctctgc
cgccggtgctaccgcctgaagcacctgtcccccacggaccccgtgctctggctgcgcagc
gtggaccgctcgctgcttctgcagggctggcaggaccagggcttcatcacgccggccaac
gtggtcttcctctacatgctctgcagggatgttatctcctccgaggtgggctcggatcac
gagctccaggccgtcctgctgacatgcctgtacctctcctactcctacatgggcaacgag
atctcctacccgctcaagcccttcctggtggagagctgcaaggaggccttttgggaccgt
tgcctctctgtcatcaacctcatgagctcaaagatgctgcagataaatgccgacccacac
tacttcacacaggtcttctccgacctgaagaacgagagcggccaggaggacaagaagcgg
ctcctcctaggcctggatcggtga

DBGET integrated database retrieval system