KEGG   Homo sapiens (human): 8854Help
Entry
8854              CDS       T01001                                 

Gene name
ALDH1A2, RALDH(II), RALDH2, RALDH2-T
Definition
(RefSeq) aldehyde dehydrogenase 1 family member A2
  KO
K07249  retinal dehydrogenase [EC:1.2.1.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    8854 (ALDH1A2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     8854 (ALDH1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 8854
NCBI-ProteinID: NP_003879
OMIM: 603687
HGNC: 15472
Ensembl: ENSG00000128918
Vega: OTTHUMG00000132624
Pharos: O94788(Tbio)
UniProt: O94788
Structure
PDB: 

Position
15q21.3
AA seq 518 aa AA seqDB search
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNP
ATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVL
ATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILP
GYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQG
PQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQ
SPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgacttccagcaagatagagatgcccggcgaggtgaaggccgaccccgccgccctcatg
gcgtcgctgcacctcctgccgtcgcccacgcccaatctcgaaattaagtacaccaagatc
tttataaacaacgagtggcagaactcagagagtgggagagtgttccctgtctataatcca
gccacaggagaacaggtgtgtgaagttcaagaagcagacaaggcagatatagacaaagca
gtgcaggcagcccgcctggctttctctcttggttcagtgtggagaaggatggatgcttca
gaaaggggacgtctgttggataagcttgcagacttggtggaacgggacagggcagttctt
gcaaccatggaatccctaaatggtggcaaaccattcctgcaagctttttatgtggatttg
cagggcgtcatcaaaacctttcgatattacgcaggctgggctgataaaattcatgggatg
accattcctgtagatggagactattttacctttacaagacatgaacccattggagtgtgt
ggacagatcatcccatggaacttccccctgctgatgtttgcctggaaaatagctccagct
ttgtgctgtggcaatacagtagttattaagccagcagagcaaacaccactcagtgcactc
tacatgggagccctcatcaaggaggctggctttcctcccggggtcatcaatattttgcca
ggatatgggccaacggctggggcagcaatagcttctcacattggcatagacaagattgca
ttcacagggtctactgaggttggaaagcttatccaagaagcagctggaagaagtaatttg
aagagagtaactctggaacttggaggcaaaagtcctaatattatttttgctgatgctgac
ttggactatgctgtggagcaggcccaccagggtgtgttcttcaatcaaggtcagtgctgc
actgcaggctctcgcatcttcgtggaggagtccatctatgaggagtttgtgagaagaagc
gtggagcgggccaagaggcgcgtagtggggagtccctttgaccccaccactgagcagggt
ccccagattgataagaaacagtacaacaagatcttggaactcatccagagtggtgtggct
gagggcgccaagctggaatgtggaggcaaaggactgggccgaaaggggtttttcattgag
cccacagtgttttccaacgtcactgatgatatgcggattgccaaggaggagatctttggc
cctgttcaggaaattttgagatttaagacgatggatgaagttatcgaaagagccaataac
tcagactttggactcgtagcagctgtctttactaatgacatcaacaaggccctcacagtg
tcttctgcaatgcaagctgggactgtttggatcaattgttacaatgccttaaatgcccag
agcccctttgggggattcaagatgtctggaaatgggagagaaatgggagaatttggcttg
cgggagtactcagaagttaagacggtgacagtaaagatcccccagaagaactcctaa

DBGET integrated database retrieval system