KEGG   Homo sapiens (human): 8856Help
Entry
8856              CDS       T01001                                 

Gene name
NR1I2, BXR, ONR1, PAR, PAR1, PAR2, PARq, PRR, PXR, SAR, SXR
Definition
(RefSeq) nuclear receptor subfamily 1 group I member 2
  KO
K08540  pregnane X receptor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8856 (NR1I2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    8856 (NR1I2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    8856 (NR1I2)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   8856 (NR1I2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep zf-RRPl_C4
Motif
Other DBs
NCBI-GeneID: 8856
NCBI-ProteinID: NP_003880
OMIM: 603065
HGNC: 7968
Ensembl: ENSG00000144852
Vega: OTTHUMG00000159400
Pharos: O75469(Tchem)
UniProt: O75469
Structure
PDB: 

Position
3q13.33
AA seq 434 aa AA seqDB search
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
ATPLMQELFGITGS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ctggaggtgagacccaaagaaagctggaaccatgctgactttgtacactgtgaggacaca
gagtctgttcctggaaagcccagtgtcaacgcagatgaggaagtcggaggtccccaaatc
tgccgtgtatgtggggacaaggccactggctatcacttcaatgtcatgacatgtgaagga
tgcaagggctttttcaggagggccatgaaacgcaacgcccggctgaggtgccccttccgg
aagggcgcctgcgagatcacccggaagacccggcgacagtgccaggcctgccgcctgcgc
aagtgcctggagagcggcatgaagaaggagatgatcatgtccgacgaggccgtggaggag
aggcgggccttgatcaagcggaagaaaagtgaacggacagggactcagccactgggagtg
caggggctgacagaggagcagcggatgatgatcagggagctgatggacgctcagatgaaa
acctttgacactaccttctcccatttcaagaatttccggctgccaggggtgcttagcagt
ggctgcgagttgccagagtctctgcaggccccatcgagggaagaagctgccaagtggagc
caggtccggaaagatctgtgctctttgaaggtctctctgcagctgcggggggaggatggc
agtgtctggaactacaaacccccagccgacagtggcgggaaagagatcttctccctgctg
ccccacatggctgacatgtcaacctacatgttcaaaggcatcatcagctttgccaaagtc
atctcctacttcagggacttgcccatcgaggaccagatctccctgctgaagggggccgct
ttcgagctgtgtcaactgagattcaacacagtgttcaacgcggagactggaacctgggag
tgtggccggctgtcctactgcttggaagacactgcaggtggcttccagcaacttctactg
gagcccatgctgaaattccactacatgctgaagaagctgcagctgcatgaggaggagtat
gtgctgatgcaggccatctccctcttctccccagaccgcccaggtgtgctgcagcaccgc
gtggtggaccagctgcaggagcaattcgccattactctgaagtcctacattgaatgcaat
cggccccagcctgctcataggttcttgttcctgaagatcatggctatgctcaccgagctc
cgcagcatcaatgctcagcacacccagcggctgctgcgcatccaggacatacaccccttt
gctacgcccctcatgcaggagttgttcggcatcacaggtagctga

DBGET integrated database retrieval system