KEGG   Homo sapiens (human): 886Help
Entry
886               CDS       T01001                                 

Gene name
CCKAR, CCK-A, CCK1-R, CCK1R, CCKRA
Definition
(RefSeq) cholecystokinin A receptor
  KO
K04194  cholecystokinin A receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04911  Insulin secretion
hsa04972  Pancreatic secretion
Drug target
Ceruletide (DG01165): D03442 D03443
Devazepide: D02693
Loxiglumide: D01113
Panazepide: D01858
Tarazepide: D02710
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    886 (CCKAR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    886 (CCKAR)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    886 (CCKAR)
  09154 Digestive system
   04972 Pancreatic secretion
    886 (CCKAR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    886 (CCKAR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    886 (CCKAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 CholecysA-Rec_N 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 886
NCBI-ProteinID: NP_000721
OMIM: 118444
HGNC: 1570
Ensembl: ENSG00000163394
Vega: OTTHUMG00000128567
Pharos: P32238(Tclin)
UniProt: P32238
Position
4p15.2
AA seq 428 aa AA seqDB search
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
MSASVPPQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggttgacagccttcttgtgaatggaagcaacatcactcctccctgtgaactc
gggctcgaaaatgagacgcttttctgcttggatcagccccgtccttccaaagagtggcag
ccagcggtgcagattctcttgtactccttgatattcctgctcagcgtgctgggaaacacg
ctggtcatcaccgtgctgattcggaacaagcggatgcggacggtcaccaacatcttcctc
ctctccctggctgtcagcgacctcatgctctgtctcttctgcatgccgttcaacctcatc
cccaatctgctcaaggatttcatcttcgggagcgccgtttgcaagaccaccacctacttc
atgggcacctctgtgagtgtatctacctttaatctggtagccatatctctagagagatat
ggtgcgatttgcaaacccttacagtcccgggtctggcagacaaaatcccatgctttgaag
gtgattgctgctacctggtgcctttcctttaccatcatgactccgtaccccatttatagc
aacttggtgccttttaccaaaaataacaaccagaccgcgaatatgtgccgctttctactg
ccaaatgatgttatgcagcagtcctggcacacattcctgttactcatcctctttcttatt
cctggaattgtgatgatggtggcatatggattaatctctttggaactctaccagggaata
aaatttgaggctagccagaagaagtctgctaaagaaaggaaacctagcaccaccagcagc
ggcaaatatgaggacagcgatgggtgttacctgcaaaagaccaggcccccgaggaagctg
gagctccggcagctgtccaccggcagcagcagcagggccaaccgcatccggagtaacagc
tccgcagccaacctgatggccaagaaaagggtgatccgcatgctcatcgtcatcgtggtc
ctcttcttcctgtgctggatgcccatcttcagcgccaacgcctggcgggcctacgacacc
gcctccgcagagcgccgcctctcaggaacccccatttccttcatcctcctcctgtcctac
acctcctcctgcgtcaaccccatcatctactgcttcatgaacaaacgcttccgcctcggc
ttcatggccaccttcccctgctgccccaatcctggtcccccaggggcgaggggagaggtg
ggggaggaggaggaaggcgggaccacaggagcctctctgtccaggttctcgtacagccat
atgagtgcctcggtgccaccccagtga

KEGG   Homo sapiens (human): 887Help
Entry
887               CDS       T01001                                 

Gene name
CCKBR, CCK-B, CCK2R, GASR
Definition
(RefSeq) cholecystokinin B receptor
  KO
K04195  cholecystokinin B receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04971  Gastric acid secretion
Drug target
Panazepide: D01858
Pentagastrin: D01631
Proglumide: D01818
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    887 (CCKBR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    887 (CCKBR)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    887 (CCKBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    887 (CCKBR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    887 (CCKBR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 887
NCBI-ProteinID: NP_795344
OMIM: 118445
HGNC: 1571
Ensembl: ENSG00000110148
Vega: OTTHUMG00000133380
Pharos: P32239(Tclin)
UniProt: P32239
Position
11p15.4
AA seq 447 aa AA seqDB search
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
PDEDPPTPSIASLSRLSYTTISTLGPG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctaaagctgaaccggagcgtgcagggaaccggacccgggccgggggcttcc
ctgtgccgcccgggggcgcctctcctcaacagcagcagtgtgggcaacctcagctgcgag
ccccctcgcattcgcggagccgggacacgagaattggagctggccattagaatcactctt
tacgcagtgatcttcctgatgagcgttggaggaaatatgctcatcatcgtggtcctggga
ctgagccgccgcctgaggactgtcaccaatgccttcctcctctcactggcagtcagcgac
ctcctgctggctgtggcttgcatgcccttcaccctcctgcccaatctcatgggcacattc
atctttggcaccgtcatctgcaaggcggtttcctacctcatgggggtgtctgtgagtgtg
tccacgctaagcctcgtggccatcgcactggagcggtacagcgccatctgccgaccactg
caggcacgagtgtggcagacgcgctcccacgcggctcgcgtgattgtagccacgtggctg
ctgtccggactactcatggtgccctaccccgtgtacactgtcgtgcaaccagtggggcct
cgtgtgctgcagtgcgtgcatcgctggcccagtgcgcgggtccgccagacctggtccgta
ctgctgcttctgctcttgttcttcatcccgggtgtggttatggccgtggcctacgggctt
atctctcgcgagctctacttagggcttcgctttgacggcgacagtgacagcgacagccaa
agcagggtccgaaaccaaggcgggctgccaggggctgttcaccagaacgggcgttgccgg
cctgagactggcgcggttggcgaagacagcgatggctgctacgtgcaacttccacgttcc
cggcctgccctggagctgacggcgctgacggctcctgggccgggatccggctcccggccc
acccaggccaagctgctggctaagaagcgcgtggtgcgaatgttgctggtgatcgttgtg
cttttttttctgtgttggttgccagtttatagtgccaacacgtggcgcgcctttgatggc
ccgggtgcacaccgagcactctcgggtgctcctatctccttcattcacttgctgagctac
gcctcggcctgtgtcaaccccctggtctactgcttcatgcaccgtcgctttcgccaggcc
tgcctggaaacttgcgctcgctgctgcccccggcctccacgagctcgccccagggctctt
cccgatgaggaccctcccactccctccattgcttcgctgtccaggcttagctacaccacc
atcagcacactgggccctggctga

DBGET integrated database retrieval system