KEGG   Homo sapiens (human): 8863Help
Entry
8863              CDS       T01001                                 

Gene name
PER3, FASPS3, GIG13
Definition
(RefSeq) period circadian regulator 3
  KO
K21945  period circadian protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04713  Circadian entrainment
hsa05168  Herpes simplex infection
Disease
H00688  Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    8863 (PER3)
   04713 Circadian entrainment
    8863 (PER3)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    8863 (PER3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8863 (PER3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    8863 (PER3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Period_C PAS_3 PAS PAS_11 DNA_Packaging
Motif
Other DBs
NCBI-GeneID: 8863
NCBI-ProteinID: NP_058515
OMIM: 603427
HGNC: 8847
Ensembl: ENSG00000049246
Vega: OTTHUMG00000001216
Pharos: P56645(Tbio)
UniProt: P56645 A2I2N5
Position
1p36.23
AA seq 1201 aa AA seqDB search
MPRGEAPGPGRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQ
EMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELAT
IASEHTSKNTDTFVAVFSFLSGRLVHISEQAALILNRKKDVLASSHFVDLLAPQDMRVFY
AHTARAQLPFWNNWTQRAARYECAPVKPFFCRIRGGEDRKQEKCHSPFRIIPYLIHVHHP
AQPELESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTPGCVFLEVDEKAVPLLGYLPQ
DLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYIILDSSWSSFV
NPWSRKISFIIGRHKVRTSPLNEDVFATKIKKMNDNDKDITELQEQIYKLLLQPVHVSVS
SGYGSLGSSGSQEQLVSIASSSEASGHRVEETKAEQMTLQQVYASVNKIKNLGQQLYIES
MTKSSFKPVTGTRTEPNGGGECKTFTSFHQTLKNNSVYTEPCEDLRNDEHSPSYQQINCI
DSVIRYLKSYNIPALKRKCISCTNTTSSSSEEDKQNHKADDVQALQAGLQIPAIPKSEMP
TNGRSIDTGGGAPQILSTAMLSLGSGISQCGYSSTIVHVPPPETARDATLFCEPWTLNMQ
PAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFREKILSSPYSSYLQQESRSKAKYSYF
QGDSTSKQTRSAGCRKGKHKRKKLPEPPDSSSSNTGSGPRRGAHQNAQPCCPSAASSPHT
SSPTFPPAAMVPSQAPYLVPAFPLPAATSPGREYAAPGTAPEGLHGLPLSEGLQPYPAFP
FPYLDTFMTVFLPDPPVCPLLSPSFLPCPFLGATASSAISPSMSSAMSPTLDPPPSVTSQ
RREEEKWEAQSEGHPFITSRSSSPLQLNLLQEEMPRPSESPDQMRRNTCPQTEYCVTGNN
GSESSPATTGALSTGSPPRENPSHPTASALSTGSPPMKNPSHPTASALSTGSPPMKNPSH
PTASTLSMGLPPSRTPSHPTATVLSTGSPPSESPSRTGSAASGSSDSSIYLTSSVYSSKI
SQNGQQSQDVQKKETFPNVAEEPIWRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESM
RQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDS
C
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcggggaagctcctggccccgggagacggggggctaaggacgaggccctgggc
gaagaatcgggggagcggtggagccccgagttccatctgcagaggaaattggcggacagc
agccacagtgaacagcaagatcgaaacagagtttctgaagaacttatcatggttgtccaa
gaaatgaaaaaatacttcccctcggagagacgcaataaaccaagcactctagatgccctc
aactatgctctccgctgtgtccacagcgttcaagcaaacagtgagtttttccagattctc
agtcagaatggagcacctcaggcagatgtgagcatgtacagtcttgaggagctggccact
atcgcttcagaacacacttccaaaaacacagatacctttgtggcagtattttcatttctg
tctggaaggttagtgcacatttctgaacaggctgctttgatcctgaatcgtaagaaagat
gtcctggcgtcttctcactttgttgacctgcttgcacctcaagacatgagggtattctac
gcgcacactgccagagctcagcttcctttctggaacaactggacccaaagagctgcacgg
tatgaatgtgctccggtgaaaccttttttctgcaggatccgtggaggtgaagacagaaag
caagagaagtgtcactccccattccggatcatcccctatctgattcatgtacatcaccct
gcccagccagaattggaatcggaaccttgctgtctcactgtggttgaaaagattcactct
ggttatgaagctcctcggatcccagtgaataaaagaatcttcaccaccacacacacccca
gggtgtgtttttcttgaagtagatgaaaaagcagtgcctttgctgggttacctacctcag
gacctgattggaacatcgatcctaagctacctgcaccctgaagatcgttctctgatggtt
gccatacaccaaaaagttttgaagtatgcagggcatcctccctttgaacattctcccatt
cgattttgtactcaaaacggagactacatcatactggattccagttggtccagctttgtg
aatccctggagccggaagatttctttcatcattggtcggcataaagttcgaacgagccca
ctaaatgaggatgtttttgctaccaaaattaaaaagatgaacgataatgacaaagacata
acagaattacaagaacaaatttacaaacttctcttacagccagttcacgtgagcgtgtcc
agcggctacgggagcctggggagcagcgggtcgcaggagcagcttgtcagcatcgcctcc
tccagtgaggccagtgggcaccgtgtggaggagacgaaggcggagcagatgaccttgcag
caggtctatgccagtgtgaacaaaattaaaaatctgggtcagcagctctacattgagtca
atgaccaaatcatcattcaagccagtgacggggacacgcacagaaccgaatggtggtggt
gaatgtaagacctttacttccttccaccaaacactgaaaaacaatagtgtgtacactgag
ccctgtgaggatttgaggaacgatgagcacagcccatcctatcaacagatcaactgtatc
gacagtgtcatcagatacctgaagagctacaacattccagctttgaaaagaaagtgtatc
tcctgtacaaatacaacttcttcctcctcagaagaagacaaacagaaccacaaggcagat
gatgtccaagccttacaagctggtttgcaaatcccagccatacctaaatcagaaatgcca
acaaatggacggtccatagacacaggaggaggagctccacagatcctgtccacggcgatg
ctgagcttggggtcgggcataagccaatgcggttacagcagcaccattgtccatgtccca
cccccagagacagccagggatgctaccctcttctgtgagccctggaccctgaacatgcag
ccagcccctttgacctcggaagaatttaaacacgtggggctcacagcggctgttctgtca
gcgcacacccagaaggaagagcagaattatgttgataaattccgagaaaagatcctgtca
tcaccctacagctcctatcttcagcaagaaagcaggagcaaagctaaatattcatatttt
caaggagattctacttccaagcagacgcggtcggccggctgcaggaaagggaagcacaag
cggaagaagctgccggagccgccagacagcagcagctcgaacaccggctctggtccccgc
aggggagcgcatcagaacgcacagccctgctgcccctccgcggcctcctctccgcacacc
tcgagcccgaccttcccacctgccgccatggtgcccagccaggccccttacctcgtccca
gcttttcccctcccagccgcgacctcacccggaagagaatacgcagcccccggaactgca
ccggaaggcctgcatgggctgcccttgtccgagggcttgcagccttacccagctttccct
tttccttacttggatacttttatgaccgttttcctgcctgacccccctgtctgtcctctg
ttgtcgccatcgtttttgccatgtccattcctgggggcgacagcctcttctgcgatatca
ccctcaatgtcgtcagcaatgagtccaactctggacccacccccttcagtcaccagccaa
aggagagaggaggaaaagtgggaggcacaaagcgaggggcacccgttcattacttcgaga
agcagctcacccttgcagttaaacttacttcaggaagagatgcccagaccctctgaatct
ccagatcagatgagaaggaacacgtgcccacaaactgagtattgtgttacaggcaacaat
ggcagtgagagcagtcctgctactaccggtgcactgtccacggggtcacctcccagggag
aatccatcccatcctactgccagcgctctgtccacaggatcgcctcccatgaagaatcca
tcccatcctactgccagcgctctgtccacaggatcgcctcccatgaagaatccatcccat
cctactgccagcacactgtccatgggattgcctcccagcaggactccatcccatcctact
gccactgttctgtccacggggtcacctcccagcgaatccccatccagaactggttcagca
gcatcaggaagcagcgacagcagtatataccttactagtagtgtttattcttctaaaatc
tcccaaaatgggcagcaatctcaggacgtacagaaaaaagaaacatttcctaatgtcgcc
gaagagcccatctggagaatgatacggcagacacctgagcgcattctcatgacataccag
gtacctgagagggttaaagaagttgtactaaaagaagacctggaaaagctagaaagtatg
aggcagcagcagccccagttttctcatgggcaaaaggaggagctggctaaggtgtataat
tggattcaaagccagactgtcactcaagaaatcgacattcaagcctgtgtcacttgtgaa
aatgaagattcagctgatggtgcggccacatcctgtggtcaggttctggtagaagacagc
tgttga

DBGET integrated database retrieval system