KEGG   Homo sapiens (human): 8864Help
Entry
8864              CDS       T01001                                 

Gene name
PER2, FASPS, FASPS1
Definition
(RefSeq) period circadian regulator 2
  KO
K02633  period circadian protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04713  Circadian entrainment
hsa05168  Herpes simplex infection
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
N00111  AML1-ETO fusion to CEBPA-mediated transcription
Disease
H00688  Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    8864 (PER2)
   04713 Circadian entrainment
    8864 (PER2)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    8864 (PER2)
   05221 Acute myeloid leukemia
    8864 (PER2)
  09167 Infectious diseases
   05168 Herpes simplex infection
    8864 (PER2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8864 (PER2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    8864 (PER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Period_C PAS_3 PAS PAS_11
Motif
Other DBs
NCBI-GeneID: 8864
NCBI-ProteinID: NP_073728
OMIM: 603426
HGNC: 8846
Ensembl: ENSG00000132326
Vega: OTTHUMG00000152884
Pharos: O15055(Tbio)
UniProt: O15055
Position
2q37.3
AA seq 1255 aa AA seqDB search
MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSEGHPCGADVPSYTVEEMES
VTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFH
SFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRD
QQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQD
LIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINP
WSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSS
GYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKS
VTEMQTNPPAEKKAVPAMEKDSLGVSFPEELACKNQPTCSYQQISCLDSVIRYLESCNEA
ATLKRKCEFPANVPALRSSDKRKATVSPGPHAGEAEPPSRVNSRTGVGTHLTSLALPGKA
ESVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAASGPESLDCLAGPALACGLSQEKEPF
KKLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRN
TSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSS
CPAVPFPAPVPAAYSLPVFPAPGTVAAPPAPPHASFTVPAVPVDLQHQFAVQPPPFPAPL
APVMAFMLPSYSFPSGTPNLPQAFFPSQPQFPSHPTLTSEMASASQPEFPSRTSIPRQPC
ACPATRATPPSAMGRASPPLFQSRSSSPLQLNLLQLEEAPEGGTGAMGTTGATETAAVGA
DCKPGTSRDQQPKAPLTRDEPSDTQNSDALSTSSGLLNLLLNEDLCSASGSAASESLGSG
SLGCDASPSGAGSSDTSHTSKYFGSIDSSENNHKAKMNTGMEESEHFIKCVLQDPIWLLM
ADADSSVMMTYQLPSRNLEAVLKEDREKLKLLQKLQPRFTESQKQELREVHQWMQTGGLP
AAIDVAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQT
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atgaatggatacgcggaatttccgcccagccccagtaaccccaccaaggagcccgtggag
ccccagcccagccaggtcccactgcaggaagatgtggacatgagcagtggctccagtgga
catgagaccaacgaaaactgctccacggggcgggactcgcagggcagtgactgtgacgac
agtgggaaggagctggggatgctggtggagccaccggatgcccgccagagtccagatacc
tttagcctgatgatggcaaaatctgaacacaacccatctacaagtggctgcagtagcgac
cagtcttcgaaagtggacacacacaaagaactgataaaaacactaaaggagctgaaggtc
cacctccctgcagacaagaaggccaagggcaaggccagtacgctggccaccttgaagtac
gccctcaggagcgtgaagcaggtgaaagccaatgaagagtattaccagctgctgatgtcc
agcgagggtcacccctgtggagcagacgtgccctcctacaccgtggaggagatggagagc
gttacctctgagcacattgtgaagaatgccgatatgtttgcggtggccgtgtccctggtg
tctgggaagatcctgtacatctctgaccaggttgcatccatatttcactgtaaaagagat
gccttcagcgatgccaagtttgtggagttcctggcgcctcacgatgtgggcgtgttccac
agtttcacctccccgtacaagcttcccttgtggagcatgtgcagtggagcagattctttt
actcaagaatgcatggaggagaaatctttcttttgccgtgtcagtgtccggaaaagccac
gagaatgaaatccgctaccaccccttccgcatgacgccctacctggtcaaggtgcgggac
caacaaggtgctgagagtcagctttgctgccttctgctggcagagagagtgcactctggt
tatgaagcccctagaattcctcctgaaaagagaatttttacaaccacccatacaccaaat
tgtttgttccaggatgtggatgaaagggcggtccctctcctgggctacctacctcaggac
ctgattgaaaccccagtgctcgtgcagctccaccctagtgacaggcccttgatgctggcc
atccacaaaaagatcctgcagtcaggcgggcagcctttcgactattctcccattcggttt
cgcgcccggaacggagagtacatcacgttggacaccagctggtccagcttcatcaaccca
tggagcaggaaaatctccttcatcattgggaggcacaaagtcagggtgggccctttgaat
gaggacgtgtttgcagcccacccctgcacagaggagaaggccctgcaccccagcattcag
gagctcacagagcagatccaccggctcctgctgcagcccgtcccccacagcggctccagt
ggctacgggagtctgggcagcaacgggtcccacgagcaccttatgagccagacctcctcc
agcgacagcaacggccatgaggactcacgccggaggagagccgaaatttgtaaaaatggt
aacaagaccaaaaatagaagtcattattctcatgaatctggagaacaaaagaaaaaatcc
gttacagaaatgcaaactaatcccccagctgagaagaaagctgtccctgccatggaaaag
gacagcctgggggtcagcttccccgaggagttggcctgcaagaaccagcccacctgctcc
taccagcagatcagctgcttggacagcgtcatcaggtacttggagagctgcaatgaggct
gccaccctgaagaggaaatgcgagttcccagcaaacgtcccagcgctaaggtccagtgat
aagcggaaggccacagtcagcccagggccacacgctggagaggcagagccgccctccagg
gtgaacagccgcacgggagtaggtacgcacctgacctcgctggcactgccgggcaaggca
gagagtgtggcgtcgctcaccagccagtgcagctacagcagcaccatcgtccatgtggga
gacaagaagccgcagccggagttagagatggtggaagatgctgcgagtgggccagaatcc
ctggactgcctggcgggccctgccctggcctgtggtctcagccaagagaaggagcccttc
aagaagctgggcctcaccaaggaggtactcgctgcacacacacagaaggaggagcagagc
ttcctgcagaagttcaaagaaataagaaaactcagcattttccagtcccactgccattac
tacttgcaagaaagatccaaggggcagccaagtgaacgaactgcccctggactaagaaat
acttccggaatagattcaccttggaaaaaaacaggaaagaacagaaaattgaagtccaag
cgggtcaaacctcgagactcatctgagagcaccggatctggggggcccgtgtccgcccgg
cccccgctggtgggcttgaacgccacagcctggtcaccctcagacacgtcccagtccagc
tgcccagccgtgccctttcccgccccagtgccagcagcttattcactgcccgtgtttcca
gcgccagggactgtggcagcacccccggcacctccccacgccagcttcacagtgcctgct
gtgcccgtggacctccagcaccagtttgcagtccagcccccacctttccctgcccctttg
gcgcctgtcatggcattcatgctacccagttattccttcccctcggggaccccaaacctg
ccccaggccttcttccccagccagcctcagtttccgagccaccccacactcacatccgag
atggcctctgcctcacagcctgagttccccagccggacctcgatccccagacagccatgt
gcttgtccagccacccgggccaccccaccatcggccatgggtagggcctccccaccgctc
tttcagtcccgcagcagctcgcccctgcagctcaacctgctgcagctggaggaagcccct
gagggtggcactggagccatggggaccacaggggccacagagacagcagctgtaggggcg
gactgcaaacctggcacttctcgggaccagcagccgaaggcgcctctgacccgtgatgaa
ccctcagacacacagaacagtgacgccctttccacgtcaagcggcctcctaaacctcctg
ctgaatgaggacctctgctcagcctcgggctctgctgcttcggagtctctgggctccggc
tcactgggctgcgacgcctccccgagtggggcaggcagtagtgacacaagtcataccagc
aaatattttggaagcattgactcctcagagaataatcacaaagcaaaaatgaacactggt
atggaagaaagtgagcatttcattaagtgcgtcctgcaggatcccatctggctgctgatg
gcagatgcggacagcagcgtcatgatgacgtaccagctgccttcccgaaatttagaagcg
gttttgaaggaggacagagagaagctgaagctcctacagaaactccagcccaggttcacg
gagagtcagaagcaggagctgcgcgaggtccaccagtggatgcagacgggcggcctgccc
gcagccatcgacgtggcagaatgtgtttactgtgaaaacaaggaaaaaggtaatatttgc
ataccatatgaggaagatattccttctctgggactcagcgaagtgtcggacaccaaagaa
gacgaaaatggatcccccttgaatcacaggatcgaagagcagacgtaa

DBGET integrated database retrieval system