KEGG   Homo sapiens (human): 8864Help
Entry
8864              CDS       T01001                                 

Gene name
PER2, FASPS, FASPS1
Definition
(RefSeq) period circadian regulator 2
  KO
K02633  period circadian protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04713  Circadian entrainment
hsa05168  Herpes simplex infection
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
N00111  AML1-ETO fusion to CEBPA-mediated transcription
Disease
H00688  Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    8864 (PER2)
   04713 Circadian entrainment
    8864 (PER2)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    8864 (PER2)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    8864 (PER2)
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    8864 (PER2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8864 (PER2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    8864 (PER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Period_C PAS_3 PAS PAS_11
Motif
Other DBs
NCBI-GeneID: 8864
NCBI-ProteinID: NP_073728
OMIM: 603426
HGNC: 8846
Ensembl: ENSG00000132326
Vega: OTTHUMG00000152884
Pharos: O15055(Tbio)
UniProt: O15055
Position
2q37.3
AA seq 1255 aa AA seqDB search
MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSEGHPCGADVPSYTVEEMES
VTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFH
SFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRD
QQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQD
LIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINP
WSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSS
GYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKS
VTEMQTNPPAEKKAVPAMEKDSLGVSFPEELACKNQPTCSYQQISCLDSVIRYLESCNEA
ATLKRKCEFPANVPALRSSDKRKATVSPGPHAGEAEPPSRVNSRTGVGTHLTSLALPGKA
ESVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAASGPESLDCLAGPALACGLSQEKEPF
KKLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRN
TSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSS
CPAVPFPAPVPAAYSLPVFPAPGTVAAPPAPPHASFTVPAVPVDLQHQFAVQPPPFPAPL
APVMAFMLPSYSFPSGTPNLPQAFFPSQPQFPSHPTLTSEMASASQPEFPSRTSIPRQPC
ACPATRATPPSAMGRASPPLFQSRSSSPLQLNLLQLEEAPEGGTGAMGTTGATETAAVGA
DCKPGTSRDQQPKAPLTRDEPSDTQNSDALSTSSGLLNLLLNEDLCSASGSAASESLGSG
SLGCDASPSGAGSSDTSHTSKYFGSIDSSENNHKAKMNTGMEESEHFIKCVLQDPIWLLM
ADADSSVMMTYQLPSRNLEAVLKEDREKLKLLQKLQPRFTESQKQELREVHQWMQTGGLP
AAIDVAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQT
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atgaatggatacgcggaatttccgcccagccccagtaaccccaccaaggagcccgtggag
ccccagcccagccaggtcccactgcaggaagatgtggacatgagcagtggctccagtgga
catgagaccaacgaaaactgctccacggggcgggactcgcagggcagtgactgtgacgac
agtgggaaggagctggggatgctggtggagccaccggatgcccgccagagtccagatacc
tttagcctgatgatggcaaaatctgaacacaacccatctacaagtggctgcagtagcgac
cagtcttcgaaagtggacacacacaaagaactgataaaaacactaaaggagctgaaggtc
cacctccctgcagacaagaaggccaagggcaaggccagtacgctggccaccttgaagtac
gccctcaggagcgtgaagcaggtgaaagccaatgaagagtattaccagctgctgatgtcc
agcgagggtcacccctgtggagcagacgtgccctcctacaccgtggaggagatggagagc
gttacctctgagcacattgtgaagaatgccgatatgtttgcggtggccgtgtccctggtg
tctgggaagatcctgtacatctctgaccaggttgcatccatatttcactgtaaaagagat
gccttcagcgatgccaagtttgtggagttcctggcgcctcacgatgtgggcgtgttccac
agtttcacctccccgtacaagcttcccttgtggagcatgtgcagtggagcagattctttt
actcaagaatgcatggaggagaaatctttcttttgccgtgtcagtgtccggaaaagccac
gagaatgaaatccgctaccaccccttccgcatgacgccctacctggtcaaggtgcgggac
caacaaggtgctgagagtcagctttgctgccttctgctggcagagagagtgcactctggt
tatgaagcccctagaattcctcctgaaaagagaatttttacaaccacccatacaccaaat
tgtttgttccaggatgtggatgaaagggcggtccctctcctgggctacctacctcaggac
ctgattgaaaccccagtgctcgtgcagctccaccctagtgacaggcccttgatgctggcc
atccacaaaaagatcctgcagtcaggcgggcagcctttcgactattctcccattcggttt
cgcgcccggaacggagagtacatcacgttggacaccagctggtccagcttcatcaaccca
tggagcaggaaaatctccttcatcattgggaggcacaaagtcagggtgggccctttgaat
gaggacgtgtttgcagcccacccctgcacagaggagaaggccctgcaccccagcattcag
gagctcacagagcagatccaccggctcctgctgcagcccgtcccccacagcggctccagt
ggctacgggagtctgggcagcaacgggtcccacgagcaccttatgagccagacctcctcc
agcgacagcaacggccatgaggactcacgccggaggagagccgaaatttgtaaaaatggt
aacaagaccaaaaatagaagtcattattctcatgaatctggagaacaaaagaaaaaatcc
gttacagaaatgcaaactaatcccccagctgagaagaaagctgtccctgccatggaaaag
gacagcctgggggtcagcttccccgaggagttggcctgcaagaaccagcccacctgctcc
taccagcagatcagctgcttggacagcgtcatcaggtacttggagagctgcaatgaggct
gccaccctgaagaggaaatgcgagttcccagcaaacgtcccagcgctaaggtccagtgat
aagcggaaggccacagtcagcccagggccacacgctggagaggcagagccgccctccagg
gtgaacagccgcacgggagtaggtacgcacctgacctcgctggcactgccgggcaaggca
gagagtgtggcgtcgctcaccagccagtgcagctacagcagcaccatcgtccatgtggga
gacaagaagccgcagccggagttagagatggtggaagatgctgcgagtgggccagaatcc
ctggactgcctggcgggccctgccctggcctgtggtctcagccaagagaaggagcccttc
aagaagctgggcctcaccaaggaggtactcgctgcacacacacagaaggaggagcagagc
ttcctgcagaagttcaaagaaataagaaaactcagcattttccagtcccactgccattac
tacttgcaagaaagatccaaggggcagccaagtgaacgaactgcccctggactaagaaat
acttccggaatagattcaccttggaaaaaaacaggaaagaacagaaaattgaagtccaag
cgggtcaaacctcgagactcatctgagagcaccggatctggggggcccgtgtccgcccgg
cccccgctggtgggcttgaacgccacagcctggtcaccctcagacacgtcccagtccagc
tgcccagccgtgccctttcccgccccagtgccagcagcttattcactgcccgtgtttcca
gcgccagggactgtggcagcacccccggcacctccccacgccagcttcacagtgcctgct
gtgcccgtggacctccagcaccagtttgcagtccagcccccacctttccctgcccctttg
gcgcctgtcatggcattcatgctacccagttattccttcccctcggggaccccaaacctg
ccccaggccttcttccccagccagcctcagtttccgagccaccccacactcacatccgag
atggcctctgcctcacagcctgagttccccagccggacctcgatccccagacagccatgt
gcttgtccagccacccgggccaccccaccatcggccatgggtagggcctccccaccgctc
tttcagtcccgcagcagctcgcccctgcagctcaacctgctgcagctggaggaagcccct
gagggtggcactggagccatggggaccacaggggccacagagacagcagctgtaggggcg
gactgcaaacctggcacttctcgggaccagcagccgaaggcgcctctgacccgtgatgaa
ccctcagacacacagaacagtgacgccctttccacgtcaagcggcctcctaaacctcctg
ctgaatgaggacctctgctcagcctcgggctctgctgcttcggagtctctgggctccggc
tcactgggctgcgacgcctccccgagtggggcaggcagtagtgacacaagtcataccagc
aaatattttggaagcattgactcctcagagaataatcacaaagcaaaaatgaacactggt
atggaagaaagtgagcatttcattaagtgcgtcctgcaggatcccatctggctgctgatg
gcagatgcggacagcagcgtcatgatgacgtaccagctgccttcccgaaatttagaagcg
gttttgaaggaggacagagagaagctgaagctcctacagaaactccagcccaggttcacg
gagagtcagaagcaggagctgcgcgaggtccaccagtggatgcagacgggcggcctgccc
gcagccatcgacgtggcagaatgtgtttactgtgaaaacaaggaaaaaggtaatatttgc
ataccatatgaggaagatattccttctctgggactcagcgaagtgtcggacaccaaagaa
gacgaaaatggatcccccttgaatcacaggatcgaagagcagacgtaa

DBGET integrated database retrieval system