KEGG   Homo sapiens (human): 8874
Entry
8874              CDS       T01001                                 

Gene name
ARHGEF7, BETA-PIX, COOL-1, COOL1, Nbla10314, P50, P50BP, P85, P85COOL1, P85SPR, PAK3, PIXB
Definition
(RefSeq) Rho guanine nucleotide exchange factor 7
  KO
K13710  Rho guanine nucleotide exchange factor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01070  ITGA/B-FAK-CDC42 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8874 (ARHGEF7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    8874 (ARHGEF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8874 (ARHGEF7)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    8874 (ARHGEF7)
SSDB
Motif
Pfam: RhoGEF67_u2 RhoGEF SH3_2 SH3_1 SH3_9 RhoGEF67_u1 CH PH CAMSAP_CH Mucin_bdg GAS
Other DBs
NCBI-GeneID: 8874
NCBI-ProteinID: NP_001106983
OMIM: 605477
HGNC: 15607
Ensembl: ENSG00000102606
Vega: OTTHUMG00000017357
Pharos: Q14155(Tbio)
UniProt: Q14155 Q5W9H1
Structure
PDB: 
5SXP 2L3G 1ZSG 1BY1

Position
13q34
AA seq 803 aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEP
RSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNK
VLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVRE
VKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRP
LQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL
ERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNV
TYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSE
NHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSH
PVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPP
LRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAY
CTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIW
TAHSYRMGSTSRKSCCSYISHQN
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgaattccgccgagcaaaccgttacgtggctcatcactctgggggtgctggagtcgccc
aaaaaaaccatctcggacccggagggctttctgcaggcgtcgctgaaggatggggtggtc
ctctgcaggctgctggagcgcctgctccccgggaccatcgagaaagtctaccccgagccc
cggagcgagagcgagtgcctgagcaacatccgcgagttcctgcgcggctgcggggcttcc
ctgcggctggagctcctgtttcctccttcccagcctcctcagcatctggtaaccaccatt
ctcttgtctgcttctacgtttgatgcaaatgatttgtatcaggggcagaattttaacaag
gtcctcagttccttagtgactctaaataaagtaacagcagacatcgggctggggagtgac
tccgtgtgtgcccggccctcgtctcaccgcataaagtcttttgactcccttggatcacag
tctttgcacactcggacttcaaaactgttccagggccagtatcggagtttggacatgacc
gataatagcaacaatcaactggtagtaagagcaaagtttaacttccagcagaccaatgag
gacgagctttccttctcaaaaggagacgtcatccatgtcacccgtgtggaagagggaggc
tggtgggagggcacactcaacggccggaccggctggttccccagcaactacgtgcgcgag
gtcaaggccagcgagaagcctgtgtctcccaaatcaggaacactgaagagccctcccaaa
ggatttgatacgactgccataaacaaaagctattacaatgtggtgctacagaatatttta
gaaacagaaaatgaatattctaaagaacttcagactgtgctttcaacgtacctacggcca
ttgcagaccagtgagaagttaagttcagcaaacatttcatatttaatgggaaatctagaa
gaaatatgttctttccagcaaatgctcgtacagtctttagaagaatgcaccaagttgccc
gaagctcagcagagagtcggaggctgctttttaaacctgatgccacagatgaaaaccctg
tacctcacgtattgtgccaatcacccttctgcagtgaatgtcctcacggaacacagtgag
gagttgggggagttcatggagaccaaaggtgccagcagccctgggattctcgtgctgacc
acgggcctgagcaaacccttcatgcgcctggataaataccctacgctgctcaaagagctc
gagagacacatggaggattatcatacagatagacaagatattcaaaaatccatggctgcc
ttcaaaaacctttcagcccaatgtcaagaagtccggaagaggaaagagcttgagctgcag
atcctgacggaagccatccggaactgggagggcgatgacattaaaactctgggcaacgtc
acttacatgtcccaggtcctgattcagtgtgccggaagtgaggaaaagaatgaaagatat
cttctactcttcccaaatgttttgctaatgttgtctgccagtcctaggatgagtggcttt
atctatcagggaaagcttccaacgacaggaatgacaatcacaaagcttgaggacagtgaa
aatcatagaaatgcatttgaaatatcagggagcatgattgagcggatattagtgtcgtgc
aacaaccagcaggatctgcaggaatgggtggagcacctacagaagcaaacgaaggtcacg
tctgtgggaaaccccaccataaagcctcattcagtgccatctcataccctcccctcccac
ccggtcactccgtccagcaagcacgcagacagcaagcccgcgccgctgacgcccgcctac
cacacgctgccccacccctcccaccacggcaccccgcacaccaccatcaactggggaccc
ctggagcctccgaaaacacccaagccctggagcctgagctgcctgcggcccgcgcctccc
ctccggccctcagctgctctctgctacaaggaggatcttagtaagagccctaagaccatg
aaaaagctgctgcccaagcgcaaacctgaacggaagccttcagatgaggagttcgcgtcc
cggaaaagcacagctgctttggaagaagatgctcagattctgaaagtcattgaagcttac
tgcaccagcgccaaaacaaggcaaacactcaattcaacatggcaaggcactgacctgatg
cataatcacgtcttggctgatgatgaccaaccaagcctagactccctggggcgtcgcagt
agcctttctcgtttggagccttcagacctctcggaagactctgactatgacagtatatgg
acagcccatagttacagaatgggttctacatctcgtaagagctgttgctcatatatctct
caccagaactaa

KEGG   Homo sapiens (human): 9459
Entry
9459              CDS       T01001                                 

Gene name
ARHGEF6, COOL2, Cool-2, MRX46, PIXA, alpha-PIX, alphaPIX
Definition
(RefSeq) Rac/Cdc42 guanine nucleotide exchange factor 6
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05212  Pancreatic cancer
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    9459 (ARHGEF6)
 09160 Human Diseases
  09162 Cancer: specific types
   05212 Pancreatic cancer
    9459 (ARHGEF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9459 (ARHGEF6)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    9459 (ARHGEF6)
SSDB
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF CH SH3_2 RhoGEF67_u1 SH3_9 SH3_1 PH CAMSAP_CH Nsp1_C ZapB
Other DBs
NCBI-GeneID: 9459
NCBI-ProteinID: NP_004831
OMIM: 300267
HGNC: 685
Ensembl: ENSG00000129675
Vega: OTTHUMG00000022518
Pharos: Q15052(Tbio)
UniProt: Q15052 Q8N4Q3
Structure
PDB: 
1WYR 1UJY

Position
Xq26.3
AA seq 776 aa
MNPEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDP
QTEADCINNINDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAANTSQTNPQGAVSSTVSGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETAPLTKN
YYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTVEVTSLLGNFEEVCTFQQTLC
QALEECSKFPENQHKVGGCLLSLMPHFKSMYLAYCANHPSAVNVLTQHSDELEQFMENQG
ASSPGILILTTNLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIVAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKNLGNVIFMSQVMVQYGACEEKEERYLMLFSNVLIM
LSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWL
EQLNRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPL
RPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQIL
KVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEEKLIIEETRSNGQTIMEEKSLVDTVYA
LKDEVRELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRGESSSKTSILP
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgaatccagaagaacaaatcgtgacatggcttatatctttgggagttttagagtcccct
aaaaagaccatctgtgatccggaggagtttttaaagtcctcgctgaaaaatggggtagtt
ctgtgcaaactgatcaacagactcatgcctggctctgtggaaaagttttgtctggatccc
caaactgaagctgactgcatcaacaacatcaatgacttcctgaaaggatgtgcaaccctc
caagtggaaatatttgatcctgatgacctttattcaggggtcaatttctccaaggtactg
agtactcttttagctgtcaacaaagcaacagaagatcagctatcagaaagaccatgtgga
cgttcctcttctcttagtgctgctaatacttctcagacaaacccacagggagcagtttct
agcacagtttcagggctgcaaaggcagtcaaagacagtggagatgacggaaaatggaagt
catcagttgatagtaaaagcaagattcaactttaagcagactaatgaggatgaactgtca
gtttgtaagggggacatcatttacgtcacacgagttgaagaaggaggctggtgggaaggc
acattaaatgggagaacaggctggttccccagtaattatgtccgtgaaattaaatccagt
gagagacctctctccccaaaagccgtcaaaggatttgaaactgctccacttaccaagaat
tattatactgtggtgttacagaacatcctggacactgaaaaagaatatgctaaagaactt
cagtctcttcttgttacttacttaagacccctgcagtccaataacaatctgagtactgtg
gaggttacatctttactgggaaacttcgaggaagtatgcacatttcaacagacactctgc
caagccttggaagaatgttcaaagtttccagaaaaccagcacaaagtaggaggttgtcta
ctgagtctcatgcctcattttaaatctatgtatctggcttactgtgcaaaccatccttca
gctgtaaatgtgctcactcagcacagtgatgagttggaacaattcatggaaaatcaaggt
gcatcgagcccaggtatcctcattttaacaacaaacctcagcaaaccattcatgcgactg
gagaaatatgttactctcttgcaagagttagaacggcatatggaggatactcatccagat
catcaggatattctgaaagcaatcgtagcattcaaaactctcatggggcaatgtcaagat
ctgaggaagagaaaacagctggagttacagatactgtccgaacctattcaggcatgggaa
ggagaagatattaaaaacttgggaaatgtgatttttatgtcacaagtaatggtgcagtat
ggagcatgtgaggaaaaagaggagcggtaccttatgttattttcaaatgtcctgataatg
ttatctgcaagtcctcggatgagtggctttatctatcagggaaaaataccaatagcagga
acggtggtgactagattagatgaaattgaagggaatgactgcacatttgaaatcactggt
aacacagtggagagaattgtggtccattgtaacaacaaccaggacttccaggaatggttg
gagcagctgaacagactgatcagaggacctgcctcttgcagttcattatccaaaacctca
tcgtcatcatgtagtgctcattcttcttttagctctaccggacagccccgaggacccttg
gagcctcctcaaattataaaaccgtggagtttaagttgtctacgacctgcacctccactt
agaccatcagcagcactaggttataaagagaggatgtcttatatcttaaaggagtctagt
aaaagccctaaaacgatgaagaaatttcttcataaaaggaagactgagagaaaaccatcg
gaggaggaatatgtgattaggaaaagtacagctgctctggaagaggatgctcaaatcctt
aaagtgatcgaagcctactgcaccagcgcaaattttcaacaaggccatggctcaagtact
cgaaaagattccattccacaagtcctactccctgaggaagagaaactcatcattgaagaa
accagaagcaacggccagaccatcatggaagaaaagagccttgttgatactgtttacgcc
ttgaaggacgaggtcagagaactgaagcaggaaaataaaagaatgaagcaatgcctggaa
gaagaactgaaatcaagaagggacctagaaaagctggtgcggaggcttttgaagcaaaca
gatgagtgtattcgaggcgagtccagtagcaagacctcaattcttccataa

DBGET integrated database retrieval system