KEGG   Homo sapiens (human): 8875Help
Entry
8875              CDS       T01001                                 

Gene name
VNN2, FOAP-4, GPI-80
Definition
(RefSeq) vanin 2
  KO
K08069  pantetheine hydrolase [EC:3.5.1.92]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    8875 (VNN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.92  pantetheine hydrolase
     8875 (VNN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 8875
NCBI-ProteinID: NP_004656
OMIM: 603571
HGNC: 12706
Ensembl: ENSG00000112303
Vega: OTTHUMG00000015588
Pharos: O95498(Tbio)
UniProt: O95498
Position
6q23.2
AA seq 520 aa AA seqDB search
MVTSSFPISVAVFALITLQVGTQDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDI
LETAIKQAAEQGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTP
VQARLSCLAKDNSIYVLANLGDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKY
HLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFYDPGVTLVKDFHVDTILFPTAWMN
VLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAPNGPKVYHYDMKTELGKLL
LSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTV
CQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTMLKCKTTNLTTCGRPVE
TASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLF
GRWYTKDSLYSSCGTSNSAITYLLIFILLMIIALQNIVML
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggtcacttcctcttttccaatctctgtggcagtttttgccctaataaccctgcaggtt
ggtactcaggacagttttatagctgcagtgtatgaacatgctgtcattttgccaaataaa
acagaaacaccagtttctcaggaggatgccttgaatctcatgaacgagaatatagacatt
ctggagacagcgatcaagcaggcagctgagcagggtgctcgaatcattgtgactccagaa
gatgcactttatggatggaaatttaccagggaaactgttttcccttatctggaggatatc
ccagaccctcaggtgaactggattccgtgtcaagacccccacagatttggtcacacacca
gtacaagcaagactcagctgcctggccaaggacaactctatctatgtcttggcaaatttg
ggggacaaaaagccatgtaattcccgtgactccacatgtcctcctaatggctactttcaa
tacaataccaatgtggtgtataatacagaaggaaaactcgtggcacgttaccataagtac
cacctgtactctgagcctcagtttaatgtccctgaaaagccggagttggtgactttcaac
accgcatttggaaggtttggcattttcacgtgctttgatatattcttctatgatcctggt
gttaccctggtgaaagatttccatgtggacaccatactgtttcccacagcttggatgaac
gttttgccccttttgacagctattgaattccattcagcttgggcaatgggaatgggagtt
aatcttcttgtggccaacacacatcatgtcagcctaaatatgacaggaagtggtatttat
gcaccaaatggtcccaaagtgtatcattatgacatgaagacagagttgggaaaacttctc
ctttcagaggtggattcacatcccctatcctcgcttgcctacccaacagctgttaattgg
aatgcctacgccaccaccatcaaaccatttccagtacagaaaaacactttcaggggattt
atttccagggatgggttcaacttcacagaactttttgaaaatgcaggaaaccttacagtc
tgtcaaaaggagctttgctgtcatttaagctacagaatgttacaaaaagaagagaatgaa
gtatacgttctaggagcttttacaggattacatggccgaaggagaagagagtactggcag
gtctgcacaatgctgaagtgcaaaactactaatttgacaacttgtggacggccagtagaa
actgcttctacaagatttgaaatgttctccctcagtggcacatttggaacagagtatgtt
tttcctgaagtgctacttaccgaaattcatctgtcacctggaaaatttgaggtgctgaaa
gatgggcgtttggtaaacaagaatggatcatctgggcctatactaacagtgtcactcttt
gggaggtggtacacaaaggactcactttacagctcatgtgggaccagcaattcagcaata
acttacctgctaatattcatattattaatgatcatagctttgcaaaatattgtaatgtta
tag

DBGET integrated database retrieval system