KEGG   Homo sapiens (human): 8878Help
Entry
8878              CDS       T01001                                 

Gene name
SQSTM1, A170, DMRV, FTDALS3, NADGP, OSIL, PDB3, ZIP3, p60, p62, p62B
Definition
(RefSeq) sequestosome 1
  KO
K14381  sequestosome 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00437  Paget disease of bone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    8878 (SQSTM1)
  09143 Cell growth and death
   04217 Necroptosis
    8878 (SQSTM1)
   04218 Cellular senescence
    8878 (SQSTM1)
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    8878 (SQSTM1)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    8878 (SQSTM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8878 (SQSTM1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8878 (SQSTM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8878 (SQSTM1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   Cargo receptors
    8878 (SQSTM1)
  Pexophagy
    8878 (SQSTM1)
  Aggrephagy
    8878 (SQSTM1)
  Xenophagy
    8878 (SQSTM1)
  Other autophagy associated proteins
   Midbophagy associated proteins
    8878 (SQSTM1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    8878 (SQSTM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8878 (SQSTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UBA_5 ZZ PB1 C1_2
Motif
Other DBs
NCBI-GeneID: 8878
NCBI-ProteinID: NP_003891
OMIM: 601530
HGNC: 11280
Ensembl: ENSG00000161011
Vega: OTTHUMG00000150643
Pharos: Q13501(Tbio)
UniProt: Q13501
Structure
PDB: 

Position
5q35.3
AA seq 440 aa AA seqDB search
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgctcaccgtgaaggcctaccttctgggcaaggaggacgcggcgcgcgagatt
cgccgcttcagcttctgctgcagccccgagcctgaggcggaagccgaggctgcggcgggt
ccgggaccctgcgagcggctgctgagccgggtggccgccctgttccccgcgctgcggcct
ggcggcttccaggcgcactaccgcgatgaggacggggacttggttgccttttccagtgac
gaggaattgacaatggccatgtcctacgtgaaggatgacatcttccgaatctacattaaa
gagaaaaaagagtgccggcgggaccaccgcccaccgtgtgctcaggaggcgccccgcaac
atggtgcaccccaatgtgatctgcgatggctgcaatgggcctgtggtaggaacccgctac
aagtgcagcgtctgcccagactacgacttgtgtagcgtctgcgagggaaagggcttgcac
cgggggcacaccaagctcgcattccccagccccttcgggcacctgtctgagggcttctcg
cacagccgctggctccggaaggtgaaacacggacacttcgggtggccaggatgggaaatg
ggtccaccaggaaactggagcccacgtcctcctcgtgcaggggaggcccgccctggcccc
acggcagaatcagcttctggtccatcggaggatccgagtgtgaatttcctgaagaacgtt
ggggagagtgtggcagctgcccttagccctctgggcattgaagttgatatcgatgtggag
cacggagggaaaagaagccgcctgacccccgtctctccagagagttccagcacagaggag
aagagcagctcacagccaagcagctgctgctctgaccccagcaagccgggtgggaatgtt
gagggcgccacgcagtctctggcggagcagatgaggaagatcgccttggagtccgagggg
cgccctgaggaacagatggagtcggataactgttcaggaggagatgatgactggacccat
ctgtcttcaaaagaagtggacccgtctacaggtgaactccagtccctacagatgccagaa
tccgaagggccaagctctctggacccctcccaggagggacccacagggctgaaggaagct
gccttgtacccacatctcccgccagaggctgacccgcggctgattgagtccctctcccag
atgctgtccatgggcttctctgatgaaggcggctggctcaccaggctcctgcagaccaag
aactatgacatcggagcggctctggacaccatccagtattcaaagcatcccccgccgttg
tga

DBGET integrated database retrieval system