KEGG   Homo sapiens (human): 8878
Entry
8878              CDS       T01001                                 

Gene name
SQSTM1, A170, DMRV, FTDALS3, NADGP, OSIL, PDB3, ZIP3, p60, p62, p62B
Definition
(RefSeq) sequestosome 1
  KO
K14381  sequestosome 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01137  PINK-Parkin-mediated autophagosome formation
N01139  Mutation-inactivated p62 to PINK-Parkin-mediated autophagosome formation
N01140  TBK1-mediated autophagosome formation
N01141  Mutation-inactivated TBK1 to TBK1-mediated autophagosome formation
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00437  Paget disease of bone
H02342  Frontotemporal dementia and amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8878 (SQSTM1)
   04137 Mitophagy - animal
    8878 (SQSTM1)
  09143 Cell growth and death
   04217 Necroptosis
    8878 (SQSTM1)
   04218 Cellular senescence
    8878 (SQSTM1)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    8878 (SQSTM1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8878 (SQSTM1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    8878 (SQSTM1)
   05022 Pathways of neurodegeneration - multiple diseases
    8878 (SQSTM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    8878 (SQSTM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8878 (SQSTM1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8878 (SQSTM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8878 (SQSTM1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   Cargo receptors
    8878 (SQSTM1)
  Pexophagy
    8878 (SQSTM1)
  Aggrephagy
    8878 (SQSTM1)
  Xenophagy
    8878 (SQSTM1)
  Other autophagy associated proteins
   Midbophagy associated proteins
    8878 (SQSTM1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    8878 (SQSTM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8878 (SQSTM1)
SSDB
Motif
Pfam: UBA_5 ZZ PB1 C1_2
Other DBs
NCBI-GeneID: 8878
NCBI-ProteinID: NP_003891
OMIM: 601530
HGNC: 11280
Ensembl: ENSG00000161011
Vega: OTTHUMG00000150643
Pharos: Q13501(Tbio)
UniProt: Q13501
Structure
PDB: 

Position
5q35.3
AA seq 440 aa
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcgtcgctcaccgtgaaggcctaccttctgggcaaggaggacgcggcgcgcgagatt
cgccgcttcagcttctgctgcagccccgagcctgaggcggaagccgaggctgcggcgggt
ccgggaccctgcgagcggctgctgagccgggtggccgccctgttccccgcgctgcggcct
ggcggcttccaggcgcactaccgcgatgaggacggggacttggttgccttttccagtgac
gaggaattgacaatggccatgtcctacgtgaaggatgacatcttccgaatctacattaaa
gagaaaaaagagtgccggcgggaccaccgcccaccgtgtgctcaggaggcgccccgcaac
atggtgcaccccaatgtgatctgcgatggctgcaatgggcctgtggtaggaacccgctac
aagtgcagcgtctgcccagactacgacttgtgtagcgtctgcgagggaaagggcttgcac
cgggggcacaccaagctcgcattccccagccccttcgggcacctgtctgagggcttctcg
cacagccgctggctccggaaggtgaaacacggacacttcgggtggccaggatgggaaatg
ggtccaccaggaaactggagcccacgtcctcctcgtgcaggggaggcccgccctggcccc
acggcagaatcagcttctggtccatcggaggatccgagtgtgaatttcctgaagaacgtt
ggggagagtgtggcagctgcccttagccctctgggcattgaagttgatatcgatgtggag
cacggagggaaaagaagccgcctgacccccgtctctccagagagttccagcacagaggag
aagagcagctcacagccaagcagctgctgctctgaccccagcaagccgggtgggaatgtt
gagggcgccacgcagtctctggcggagcagatgaggaagatcgccttggagtccgagggg
cgccctgaggaacagatggagtcggataactgttcaggaggagatgatgactggacccat
ctgtcttcaaaagaagtggacccgtctacaggtgaactccagtccctacagatgccagaa
tccgaagggccaagctctctggacccctcccaggagggacccacagggctgaaggaagct
gccttgtacccacatctcccgccagaggctgacccgcggctgattgagtccctctcccag
atgctgtccatgggcttctctgatgaaggcggctggctcaccaggctcctgcagaccaag
aactatgacatcggagcggctctggacaccatccagtattcaaagcatcccccgccgttg
tga

KEGG   Homo sapiens (human): 10133
Entry
10133             CDS       T01001                                 

Gene name
OPTN, ALS12, FIP2, GLC1E, HIP7, HYPL, NRP, TFIIIA-INTP
Definition
(RefSeq) optineurin
  KO
K19946  optineurin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01137  PINK-Parkin-mediated autophagosome formation
N01138  Mutation-inactivated OPTN to PINK-Parkin-mediated autophagosome formation
N01140  TBK1-mediated autophagosome formation
N01141  Mutation-inactivated TBK1 to TBK1-mediated autophagosome formation
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00612  Primary open angle glaucoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    10133 (OPTN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10133 (OPTN)
   05022 Pathways of neurodegeneration - multiple diseases
    10133 (OPTN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10133 (OPTN)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    10133 (OPTN)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    10133 (OPTN)
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    10133 (OPTN)
  Xenophagy
   Cargo receptors
    10133 (OPTN)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10
Other DBs
NCBI-GeneID: 10133
NCBI-ProteinID: NP_001008212
OMIM: 602432
HGNC: 17142
Ensembl: ENSG00000123240
Vega: OTTHUMG00000017690
Pharos: Q96CV9(Tbio)
UniProt: Q96CV9
Structure
PDB: 
5EOF 5EOA 5B83 5AAZ 2LO4

Position
10p13
AA seq 577 aa
MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKL
NNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSER
SSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVE
IRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCL
REGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVE
ALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKK
LELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDR
AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERA
AREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAE
DRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgtcccatcaacctctcagctgcctcactgaaaaggaggacagccccagtgaaagcaca
ggaaatggacccccccacctggcccacccaaacctggacacgtttaccccggaggagctg
ctgcagcagatgaaagagctcctgaccgagaaccaccagctgaaagaagccatgaagcta
aataatcaagccatgaaagggagatttgaggagctttcggcctggacagagaaacagaag
gaagaacgccagttttttgagatacagagcaaagaagcaaaagagcgtctaatggccttg
agtcatgagaatgagaaattgaaggaagagcttggaaaactaaaagggaaatcagaaagg
tcatctgaggaccccactgatgactccaggcttcccagggccgaagcggagcaggaaaag
gaccagctcaggacccaggtggtgaggctacaagcagagaaggcagacctgttgggcatc
gtgtctgaactgcagctcaagctgaactccagcggctcctcagaagattcctttgttgaa
attaggatggctgaaggagaagcagaagggtcagtaaaagaaatcaagcatagtcctggg
cccacgagaacagtctccactggcacggcattgtctaaatataggagcagatctgcagat
ggggccaagaattacttcgaacatgaggagttaactgtgagccagctcctgctgtgccta
agggaagggaatcagaaggtggagagacttgaagttgcactcaaggaggccaaagaaaga
gtttcagattttgaaaagaaaacaagtaatcgttctgagattgaaacccagacagagggg
agcacagagaaagagaatgatgaagagaaaggcccggagactgttggaagcgaagtggaa
gcactgaacctccaggtgacatctctgtttaaggagcttcaagaggctcatacaaaactc
agcgaagctgagctaatgaagaagagacttcaagaaaagtgtcaggcccttgaaaggaaa
aattctgcaattccatcagagttgaatgaaaagcaagagcttgtttatactaacaaaaag
ttagagctacaagtggaaagcatgctatcagaaatcaaaatggaacaggctaaaacagag
gatgaaaagtccaaattaactgtgctacagatgacacacaacaagcttcttcaagaacat
aataatgcattgaaaacaattgaggaactaacaagaaaagagtcagaaaaagtggacagg
gcagtgctgaaggaactgagtgaaaaactggaactggcagagaaggctctggcttccaaa
cagctgcaaatggatgaaatgaagcaaaccattgccaagcaggaagaggacctggaaacc
atgaccatcctcagggctcagatggaagtttactgttctgattttcatgctgaaagagca
gcgagagagaaaattcatgaggaaaaggagcaactggcattgcagctggcagttctgctg
aaagagaatgatgctttcgaagacggaggcaggcagtccttgatggagatgcagagtcgt
catggggcgagaacaagtgactctgaccagcaggcttaccttgttcaaagaggagctgag
gacagggactggcggcaacagcggaatattccgattcattcctgccccaagtgtggagag
gttctgcctgacatagacacgttacagattcacgtgatggattgcatcatttaa

KEGG   Homo sapiens (human): 10241
Entry
10241             CDS       T01001                                 

Gene name
CALCOCO2, NDP52
Definition
(RefSeq) calcium binding and coiled-coil domain 2
  KO
K21348  calcium-binding and coiled-coil domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa05131  Shigellosis
hsa05164  Influenza A
Network
nt06133  RLR signaling (viruses)
nt06170  Influenza A virus (IAV)
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N00734  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
N01137  PINK-Parkin-mediated autophagosome formation
N01140  TBK1-mediated autophagosome formation
N01141  Mutation-inactivated TBK1 to TBK1-mediated autophagosome formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    10241 (CALCOCO2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    10241 (CALCOCO2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10241 (CALCOCO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10241 (CALCOCO2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10241 (CALCOCO2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Xenophagy
   Cargo receptors
    10241 (CALCOCO2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    10241 (CALCOCO2)
SSDB
Motif
Pfam: SKICH Zn-C2H2_12 NAD_binding_10 HALZ
Other DBs
NCBI-GeneID: 10241
NCBI-ProteinID: NP_005822
OMIM: 604587
HGNC: 29912
Ensembl: ENSG00000136436
Vega: OTTHUMG00000160505
Pharos: Q13137(Tbio)
UniProt: Q13137
Structure
PDB: 

Position
17q21.32
AA seq 446 aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFR
VGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGAS
IPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKK
QEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQ
EKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQ
QELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMGLDFNSLPYQV
PTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF
NCPICDKIFPATEKQIFEDHVFCHSL
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggaggagaccatcaaagatccccccacatcagctgtcttgctggatcactgtcatttc
tctcaggtcatctttaacagtgtggagaagttctacatccctggaggggacgtcacatgt
cattataccttcacccagcatttcatccctcgtcgaaaggattggattggcatctttaga
gtggggtggaagacaacccgtgagtattacaccttcatgtgggttactttgcccattgac
ctaaacaacaaatcagctaaacagcaggaagtccaattcaaagcttactacctgcccaag
gatgatgagtattaccagttctgctatgtggatgaggatggtgtggtccggggagcaagt
attcctttccaattccgtccagaaaatgaggaagacatcctggttgttaccactcaggga
gaggtggaagagattgagcagcacaacaaggagctttgcaaagaaaaccaggagctgaag
gacagctgtatcagcctccagaagcagaactcagacatgcaggctgagctccaaaagaag
caggaggagctagaaaccctacagagcatcaataagaagttggaactgaaagtgaaagaa
cagaaggactattgggagacagagctgcttcaactgaaagaacaaaaccagaagatgtcc
tcagaaaatgagaagatgggaatcagagtggatcagcttcaggcccagctgtcaactcaa
gagaaagaaatggagaagcttgttcagggagatcaagataagacagagcagttagagcag
ctgaaaaaggaaaatgaccacctctttctcagtttaactgaacagaggaaggaccagaag
aagctcgagcagacagtggagcaaatgaagcagaatgaaactactgcaatgaagaaacaa
caggaattaatggatgaaaactttgacctgtcaaaaagactgagtgagaacgaaattata
tgtaatgctctgcagagacagaaagagagattggaaggagaaaatgatcttttgaagagg
gagaacagcagattgctcagttacatgggtctggattttaattctttgccgtatcaagta
cctacttcagatgaaggaggcgcaagacaaaatccaggacttgcctatggaaacccatat
tctggtatccaagaaagttcttcccccagcccgctctccatcaagaaatgccctatctgc
aaagcagatgatatttgtgatcacaccttggagcaacagcagatgcagcccctttgtttc
aattgtccaatttgtgacaagatcttcccagctacagagaagcagatctttgaagaccac
gtgttctgccactctctctga

KEGG   Homo sapiens (human): 8887
Entry
8887              CDS       T01001                                 

Gene name
TAX1BP1, CALCOCO3, T6BP, TXBP151
Definition
(RefSeq) Tax1 binding protein 1
  KO
K21347  Tax1-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
Network
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01137  PINK-Parkin-mediated autophagosome formation
N01140  TBK1-mediated autophagosome formation
N01141  Mutation-inactivated TBK1 to TBK1-mediated autophagosome formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    8887 (TAX1BP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8887 (TAX1BP1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8887 (TAX1BP1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    8887 (TAX1BP1)
  Xenophagy
   Cargo receptors
    8887 (TAX1BP1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    8887 (TAX1BP1)
SSDB
Motif
Pfam: CALCOCO1 SKICH Zn-C2H2_12 zf-Di19 UBZ_FAAP20 Crescentin zf-C2H2_4
Other DBs
NCBI-GeneID: 8887
NCBI-ProteinID: NP_006015
OMIM: 605326
HGNC: 11575
Ensembl: ENSG00000106052
Vega: OTTHUMG00000023377
Pharos: Q86VP1(Tbio)
UniProt: Q86VP1
Structure
PDB: 

Position
7p15.2
AA seq 789 aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTA
RDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQF
RASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVS
VTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEKELYKVHLKNTEIENTKLMSE
VQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKEDTCFLKEQLRKAE
EQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENEKVKKQLADAVAELKLNAMKKD
QDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKK
TGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNK
CKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAER
KMEGQNSQSPQCFKTCSEQNGYVLTLSNAQPVLQYGNPYASQETRDGADGAFYPDEIQRP
PVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCF
DSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTH
FDQNVLNFD
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgacatcctttcaagaagtcccattgcagacttccaactttgcccatgtcatctttcaa
aatgtggccaagagttaccttcctaatgcacacctggaatgtcattacaccttaactcca
tatattcatccacatccaaaagattgggttggtatattcaaggttggatggagtactgct
cgtgattattacacgtttttatggtcccctatgcctgaacattatgtggaaggatcaaca
gtcaattgtgtactagcattccaaggatattaccttccaaatgatgatggagaattttat
cagttctgttacgttacccataagggtgaaattcgtggagcaagtacacctttccagttt
cgagcttcttctccagttgaagagctgcttactatggaagatgaaggaaattctgacatg
ttagtggtgaccacaaaagcaggccttcttgagttgaaaattgagaaaaccatgaaagaa
aaagaagaactgttaaagttaattgccgttctggaaaaagaaacagcacaacttcgagaa
caagttgggagaatggaaagagaacttaaccatgagaaagaaagatgtgaccaactgcaa
gcagaacaaaagggtcttactgaagtaacacaaagcttaaaaatggaaaatgaagagttt
aagaagaggttcagtgatgctacatccaaagcccatcagcttgaggaagatattgtgtca
gtaacacataaagcaattgaaaaagaaaccgaattagacagtttaaaggacaaactcaag
aaggcacaacatgaaagagaacaacttgaatgtcagttgaagacagagaaggatgaaaag
gaactttataaggtacatttgaagaatacagaaatagaaaataccaagcttatgtcagag
gtccagactttaaaaaatttagatgggaacaaagaaagcgtgattactcatttcaaagaa
gagattggcaggctgcagttatgtttggctgaaaaggaaaatctgcaaagaactttcctg
cttacaacctcaagtaaagaagatacttgttttttaaaggagcaacttcgtaaagcagag
gaacaggttcaggcaactcggcaagaagttgtctttctggctaaagaactcagtgatgct
gtcaacgtacgagacagaacgatggcagacctgcatactgcacgcttggaaaacgagaaa
gtgaaaaagcagttagctgatgcagtggcagaacttaaactaaatgctatgaaaaaagat
caggacaagactgatacactggaacacgaactaagaagagaagttgaagatctgaaactc
cgtcttcagatggctgcagaccattataaagaaaaatttaaggaatgccaaaggctccaa
aaacaaataaacaaactttcagatcaatcagctaataataataatgtcttcacaaagaaa
acggggaatcagcagaaagtgaatgatgcttcagtaaacacagacccagccacttctgcc
tctactgtagatgtaaagccatcaccttctgcagcagaggcagattttgacatagtaaca
aaggggcaagtctgtgaaatgaccaaagaaattgctgacaaaacagaaaagtataataaa
tgtaaacaactcttgcaggatgagaaagcaaaatgcaataaatatgctgatgaacttgca
aaaatggagctgaaatggaaagaacaagtgaaaattgctgaaaatgtaaaacttgaacta
gctgaagtacaggacaattataaagaacttaaaaggagtctagaaaatccagcagaaagg
aaaatggaaggtcagaattcccagagtcctcaatgtttcaaaacatgctcagagcaaaat
ggttatgttctcacattgtcaaatgcacaaccagttctgcaatatggtaatccttatgca
tctcaggaaacaagagatggagcagatggtgctttttacccagatgaaatacaaaggcca
cctgtcagagtcccctcttggggactggaagacaatgttgtctgcagccagcctgctcga
aactttagtcggcctgatggcttagaggactctgaggatagcaaagaagatgagaatgtg
cctactgctcctgatcctccaagtcaacatttacgtgggcatgggacaggcttttgcttt
gattccagctttgatgttcacaagaagtgtcccctctgtgagttaatgtttcctcctaac
tatgatcagagcaaatttgaagaacatgttgaaagtcactggaaggtgtgcccgatgtgc
agcgagcagttccctcctgactatgaccagcaggtgtttgaaaggcatgtgcagacccat
tttgatcagaatgttctaaattttgactag

KEGG   Homo sapiens (human): 4077
Entry
4077              CDS       T01001                                 

Gene name
NBR1, 1A1-3B, IAI3B, M17S2, MIG19
Definition
(RefSeq) NBR1 autophagy cargo receptor
  KO
K17987  next to BRCA1 gene 1 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
Network
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01137  PINK-Parkin-mediated autophagosome formation
N01140  TBK1-mediated autophagosome formation
N01141  Mutation-inactivated TBK1 to TBK1-mediated autophagosome formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    4077 (NBR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4077 (NBR1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4077 (NBR1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    4077 (NBR1)
  Pexophagy
   Other pexophagy associated proteins
    4077 (NBR1)
  Aggrephagy
   Cargo receptors
    4077 (NBR1)
  Xenophagy
    4077 (NBR1)
  Other autophagy associated proteins
   Midbophagy associated proteins
    4077 (NBR1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    4077 (NBR1)
SSDB
Motif
Pfam: N_BRCA1_IG PB1 ZZ C1_2 Sgf11 CENP-B_dimeris
Other DBs
NCBI-GeneID: 4077
NCBI-ProteinID: NP_005890
OMIM: 166945
HGNC: 6746
Ensembl: ENSG00000188554
Vega: OTTHUMG00000180878
Pharos: Q14596(Tbio)
UniProt: Q14596 A0A024R1V3
Structure
PDB: 

Position
17q21.31
AA seq 966 aa
MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINS
QGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRV
LGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEK
LVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNIC
EDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKA
EKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLP
LQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLT
LASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDP
FPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKN
VASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIE
KPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLD
AAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDE
VQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGVEAGQEPAEAG
ERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPV
TIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKAL
FAGPPVTAQPIISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNND
WYSQRY
NT seq 2901 nt   +upstreamnt  +downstreamnt
atggaaccacaggttactctaaatgtgacttttaaaaatgaaattcaaagctttctggtt
tctgatccagaaaatacaacttgggctgatatcgaagctatggtaaaagtttcatttgat
ctgaatactattcaaataaaatacctggatgaggaaaatgaagaggtatccatcaacagt
caaggagaatatgaagaagcgcttaagatggcagttaaacagggaaaccaactgcagatg
caagtccacgaagggcaccatgtcgttgatgaagccccacccccagttgtaggagcaaaa
cgactagctgccagggcagggaagaagccacttgcacattactcttcactggtgagagtc
ttgggatcagacatgaagaccccagaggatcctgcagtgcagtcgtttccacttgttcca
tgtgacacagaccagcctcaagacaagcccccagactggttcacaagctacctggagacg
ttcagagaacaagtggttaacgaaacggttgagaagcttgaacagaaattacatgaaaag
cttgtcctccagaacccatccttgggttcttgtccctcagaagtctcaatgcctacttca
gaagaaacattgtttttgccagaaaaccagttcagctggcatattgcttgcaacaactgc
caaagaaggattgttggtgtccgctaccagtgtagcctatgcccatcctacaatatctgt
gaagattgtgaagcagggccatatggccatgacactaaccacgtcctgctgaagttgcgg
agacctgttgtgggctcctctgaaccgttctgtcactcaaagtactctactcctcgtctt
cctgctgctctggaacaagtcaggctccagaaacaggttgataagaactttcttaaagca
gaaaagcaaaggttgcgagctgagaagaaacaacgtaaagcagaggtcaaggaacttaaa
aagcagcttaaactccataggaaaattcacctgtggaattcaatccatggactccagagc
cccaagtctcctttaggccgacctgagagcttgctccagtctaataccctgatgctccct
ttgcagccctgtacctccgttatgccaatgctcagtgcagcatttgtggatgagaatttg
cctgatgggactcaccttcagccaggaaccaagtttatcaaacactggaggatgaaaaat
acaggaaatgtaaagtggagtgcagacacaaagctcaagttcatgtggggaaacctgact
ttggcttccacagaaaagaaggatgttttggttccctgcctcaaggccggccatgtggga
gttgtatctgtggagttcattgccccagccttggagggaacgtatacttcccattggcgt
ctttctcacaaaggccagcaatttgggcctcgggtctggtgcagtatcatagtagatcct
ttcccctccgaagagagccctgataacattgaaaagggcatgatcagctcaagcaaaact
gatgatctcacctgccagcaagaggaaacttttcttctggctaaagaagaaagacagctt
ggtgaagtgactgagcagacagaagggacagcagcctgcatcccacagaaggcaaaaaat
gttgccagtgagagggagctctacatcccatctgtggatcttctgactgcccaggacctg
ctgtcctttgagctgttggatataaacattgttcaagagttggagagagtgccccacaac
acccctgtggatgtgactccctgcatgtctcctctgccacatgacagtcctttaatagag
aagccaggcttggggcagatagaggaagagaatgaaggggcaggatttaaagcacttcct
gattctatggtgtcagtaaagaggaaggctgagaacattgcttctgtggaggaagcagaa
gaagacctgagtgggacccagtttgtgtgtgagacagtaatccgatcccttaccttggat
gctgccccagaccacaaccctccttgcagacagaagtccttgcagatgacatttgccttg
cctgaaggaccacttggaaatgagaaggaggagattatccatatcgctgaggaagaagct
gtcatggaggaggaggaggatgaggaggatgaggaggaggaggatgagctcaaagatgaa
gttcaaagtcagtcctctgcttcctcagaggattacatcatcatcctgcctgagtgcttt
gataccagccgccccctgggggattctatgtacagctctgcgctctcacagccaggcctg
gagcgaggtgctgaaggcaagcctggggttgaggctgggcaggaaccagctgaggctggg
gaaagactccctggaggggagaaccagccacaggagcacagcataagtgacatcctcacg
acctcacagactctggaaacagtgcccctaatcccagaggtagtggagcttccaccgtca
ctgcccaggagctctccttgtgtacatcatcatggttccccaggagtggatttaccagtt
accataccagaagtttcttcagtccctgatcagatcagaggagagcccagaggctcatca
ggacttgtaaacagcagacagaagagctatgaccactcaaggcaccatcatgggagcagc
attgctggaggactggtgaagggggctttgtctgttgctgcctctgcatacaaggccctg
tttgctgggccaccagtcactgcacagccaataatttctgaagatcagacagcagccctg
atggcccatctctttgaaatgggattctgtgacaggcagctgaacctacggctgctgaag
aaacacaattacaatatcctgcaggttgtgacagaacttcttcagttaaacaacaacgac
tggtacagccaacgctattga

DBGET integrated database retrieval system