KEGG   Homo sapiens (human): 8881Help
Entry
8881              CDS       T01001                                 

Gene name
CDC16, ANAPC6, APC6, CDC16Hs, CUT9
Definition
(RefSeq) cell division cycle 16
  KO
K03353  anaphase-promoting complex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Module
hsa_M00389  APC/C complex
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8881 (CDC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    8881 (CDC16)
   04114 Oocyte meiosis
    8881 (CDC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8881 (CDC16)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    8881 (CDC16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8881 (CDC16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8881 (CDC16)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8881 (CDC16)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     8881 (CDC16)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     8881 (CDC16)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    8881 (CDC16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC3 TPR_2 TPR_1 TPR_12 TPR_8 TPR_7 TPR_10 TPR_19 TPR_11 TPR_9 TPR_16 SRP_TPR_like Dynein_light
Motif
Other DBs
NCBI-GeneID: 8881
NCBI-ProteinID: NP_001072113
OMIM: 603461
HGNC: 1720
Ensembl: ENSG00000130177
Vega: OTTHUMG00000017402
Pharos: Q13042(Tbio)
UniProt: Q13042 A0A024RDZ2
Structure
PDB: 

Position
13q34
AA seq 620 aa AA seqDB search
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETF
EIEMNESDMMLETSMSDHST
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagagcggctgcggaagcgcgtccggcagtacctcgaccagcaacagtatcaa
agtgctctattttgggcagataaagtagcttcactctctcgtgaagaaccccaggacatc
tattggttggctcagtgtctttacctgacagcacaatatcacagagccgcccatgcactt
cggtcacgaaaactggacaaattgtatgaagcatgtcgttaccttgcagctaggtgccat
tatgctgcaaaagagcaccagcaggcccttgatgttcttgacatggaagagcccatcaat
aaaagattatttgaaaaatacttgaaggacgaaagtggcttcaaagatccttccagcgac
tgggaaatgtcacagtcttcaataaagagttctatctgtcttctacgcgggaaaatctat
gatgctctagataaccgaaccctggctacctacagctacaaagaagctttgaagcttgat
gtctactgttttgaagcgttcgatcttttaacatcacatcacatgctgacagcacaagaa
gaaaaagaacttcttgaatcactaccccttagcaagctgtgtaatgaagaacaggaattg
ctgcgttttctatttgagaacaaattgaaaaaatataataagcctagtgaaacggtcatc
cctgaatctgtagatggcttgcaagagaatctggatgtggtagtgtctttagctgagaga
cattattataactgtgattttaaaatgtgctacaagcttacttctgtagtaatggagaaa
gatcctttccatgcaagttgtttacctgtacatatagggacgcttgtagagctgaataaa
gccaatgaacttttctatctttctcataaactggtggatttatatcctagtaatcctgtg
tcttggtttgcagtgggatgttactatctcatggtcggtcataaaaatgaacatgccaga
agatatctcagcaaagccacaacacttgagaaaacctatggacctgcatggatagcctat
ggacattcatttgcggtggagagtgagcacgaccaagcgatggctgcttacttcacagca
gcacagctgatgaaagggtgtcatttgcctatgctgtatattggattagaatatggtttg
accaataactcaaaactagctgaaaggttcttcagccaagctctgagcattgcaccggaa
gacccttttgttatgcatgaggtcggcgtggttgcatttcagaatggagaatggaaaaca
gccgaaaaatggtttcttgatgctttggaaaaaattaaagcaattgggaacgaggtaaca
gttgacaaatgggaacctttgttgaacaacttggggcatgtctgcagaaaacttaaaaag
tatgctgaggccttggattaccaccgtcaggcactggtgttgattcctcagaacgcatcc
acctactctgctattggatatatccacagtctgatgggcaactttgaaaatgctgtggac
tacttccacacagcccttggtcttaggcgagatgatacattttctgttacaatgcttggt
cattgcatcgaaatgtacattggtgattctgaagcttatattggagcagacattaaagac
aaattaaaatgttatgactttgatgtgcatacaatgaagacactaaaaaacattatttca
cctccgtgggatttcagggaatttgaagtagaaaaacagactgcagaagaaacggggctt
acgccattggaaacctcaaggaaaactccagattccagaccttccttggaagaaaccttt
gaaattgaaatgaatgaaagtgacatgatgttagagacatctatgtcagaccacagcacg
tga

DBGET integrated database retrieval system