KEGG   Homo sapiens (human): 8882Help
Entry
8882              CDS       T01001                                 

Gene name
ZPR1, ZNF259
Definition
(RefSeq) ZPR1 zinc finger
  KO
K06874  zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    8882 (ZPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-ZPR1 zinc-ribbons_6 HypA
Motif
Other DBs
NCBI-GeneID: 8882
NCBI-ProteinID: NP_003895
OMIM: 603901
HGNC: 13051
Ensembl: ENSG00000109917
Vega: OTTHUMG00000046114
Pharos: O75312(Tbio)
UniProt: O75312
Position
11q23.3
AA seq 459 aa AA seqDB search
MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMT
RLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKT
DSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIV
KLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGLQEEAPA
EKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKS
GGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKD
IRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAP
EDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcggccagcggggctgtggaaccagggcccccgggggctgccgtcgccccgtcgccc
gccccggccccgccgcctgcccctgatcacctgttccggcccatcagcgccgaggacgag
gagcagcagcccaccgagatcgagtcgctatgcatgaactgttactgcaatggcatgacg
cgcctcctgctcaccaagattcccttcttcagagaaataatagtgagctccttttcctgc
gagcactgtggctggaacaacacggagatccagtcggcaggcaggatccaggaccaggga
gtgcgctacactttgtctgtcagggctctggaggacatgaacagagaagtggtgaagact
gactctgctgccacaaggattcctgagctagattttgaaattcctgcctttagccagaaa
ggagctctgaccactgttgaaggattgatcacccgtgctatctctggcctggagcaggac
cagcctgcacgaagggcaaacaaagatgctacagctgaaagaattgatgagttcattgtc
aaactgaaggagctaaagcaagtagcctcccctttcactctgatcattgatgatccctca
gggaacagttttgtggaaaacccacatgctcctcagaaagatgatgccctggtgatcaca
cactacaaccggacccgacagcaggaagagatgctggggcttcaagaagaagcaccagca
gagaagccagaagaggaagatctcagaaatgaagtgctccagttcagcacaaactgccca
gaatgcaatgcccccgctcagaccaacatgaagctagtacaaatccctcactttaaggag
gttatcatcatggctaccaactgcgagaactgtgggcatcggaccaatgaggtgaaatct
ggaggagcagtagaacccttgggcaccaggatcaccctccacatcacagatgcctcagat
atgaccagagacctcctcaagtctgagacttgcagtgtggaaatcccagagctagaattt
gaactgggaatggcagtcctcgggggcaagttcaccacactggaagggctgctgaaagac
atccgggaactggtgaccaaaaatcctttcacactgggcgacagttccaatcctggacag
acggagagactacaggagtttagccagaagatggaccagatcatcgaaggtaacatgaag
gcccactttattatggatgatccagcaggaaacagttacttgcagaatgtgtatgcgcct
gaagatgatcctgagatgaaggtggagcgttacaagcgcacctttgaccaaaatgaggag
ctagggctcaatgacatgaagacagagggctatgaggcaggcctggctccgcaacggtag

DBGET integrated database retrieval system