KEGG   Homo sapiens (human): 8887Help
Entry
8887              CDS       T01001                                 

Gene name
TAX1BP1, CALCOCO3, T6BP, TXBP151
Definition
(RefSeq) Tax1 binding protein 1
  KO
K21347  Tax1-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    8887 (TAX1BP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8887 (TAX1BP1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8887 (TAX1BP1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    8887 (TAX1BP1)
  Xenophagy
   Cargo receptors
    8887 (TAX1BP1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    8887 (TAX1BP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SKICH CALCOCO1 Zn-C2H2_12 zf-Di19 DUF2935 zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 8887
NCBI-ProteinID: NP_006015
OMIM: 605326
HGNC: 11575
Ensembl: ENSG00000106052
Vega: OTTHUMG00000023377
Pharos: Q86VP1(Tbio)
UniProt: Q86VP1
Structure
PDB: 

Position
7p15.2
AA seq 789 aa AA seqDB search
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTA
RDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQF
RASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVS
VTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEKELYKVHLKNTEIENTKLMSE
VQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKEDTCFLKEQLRKAE
EQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENEKVKKQLADAVAELKLNAMKKD
QDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKK
TGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNK
CKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAER
KMEGQNSQSPQCFKTCSEQNGYVLTLSNAQPVLQYGNPYASQETRDGADGAFYPDEIQRP
PVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCF
DSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTH
FDQNVLNFD
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctttcaagaagtcccattgcagacttccaactttgcccatgtcatctttcaa
aatgtggccaagagttaccttcctaatgcacacctggaatgtcattacaccttaactcca
tatattcatccacatccaaaagattgggttggtatattcaaggttggatggagtactgct
cgtgattattacacgtttttatggtcccctatgcctgaacattatgtggaaggatcaaca
gtcaattgtgtactagcattccaaggatattaccttccaaatgatgatggagaattttat
cagttctgttacgttacccataagggtgaaattcgtggagcaagtacacctttccagttt
cgagcttcttctccagttgaagagctgcttactatggaagatgaaggaaattctgacatg
ttagtggtgaccacaaaagcaggccttcttgagttgaaaattgagaaaaccatgaaagaa
aaagaagaactgttaaagttaattgccgttctggaaaaagaaacagcacaacttcgagaa
caagttgggagaatggaaagagaacttaaccatgagaaagaaagatgtgaccaactgcaa
gcagaacaaaagggtcttactgaagtaacacaaagcttaaaaatggaaaatgaagagttt
aagaagaggttcagtgatgctacatccaaagcccatcagcttgaggaagatattgtgtca
gtaacacataaagcaattgaaaaagaaaccgaattagacagtttaaaggacaaactcaag
aaggcacaacatgaaagagaacaacttgaatgtcagttgaagacagagaaggatgaaaag
gaactttataaggtacatttgaagaatacagaaatagaaaataccaagcttatgtcagag
gtccagactttaaaaaatttagatgggaacaaagaaagcgtgattactcatttcaaagaa
gagattggcaggctgcagttatgtttggctgaaaaggaaaatctgcaaagaactttcctg
cttacaacctcaagtaaagaagatacttgttttttaaaggagcaacttcgtaaagcagag
gaacaggttcaggcaactcggcaagaagttgtctttctggctaaagaactcagtgatgct
gtcaacgtacgagacagaacgatggcagacctgcatactgcacgcttggaaaacgagaaa
gtgaaaaagcagttagctgatgcagtggcagaacttaaactaaatgctatgaaaaaagat
caggacaagactgatacactggaacacgaactaagaagagaagttgaagatctgaaactc
cgtcttcagatggctgcagaccattataaagaaaaatttaaggaatgccaaaggctccaa
aaacaaataaacaaactttcagatcaatcagctaataataataatgtcttcacaaagaaa
acggggaatcagcagaaagtgaatgatgcttcagtaaacacagacccagccacttctgcc
tctactgtagatgtaaagccatcaccttctgcagcagaggcagattttgacatagtaaca
aaggggcaagtctgtgaaatgaccaaagaaattgctgacaaaacagaaaagtataataaa
tgtaaacaactcttgcaggatgagaaagcaaaatgcaataaatatgctgatgaacttgca
aaaatggagctgaaatggaaagaacaagtgaaaattgctgaaaatgtaaaacttgaacta
gctgaagtacaggacaattataaagaacttaaaaggagtctagaaaatccagcagaaagg
aaaatggaaggtcagaattcccagagtcctcaatgtttcaaaacatgctcagagcaaaat
ggttatgttctcacattgtcaaatgcacaaccagttctgcaatatggtaatccttatgca
tctcaggaaacaagagatggagcagatggtgctttttacccagatgaaatacaaaggcca
cctgtcagagtcccctcttggggactggaagacaatgttgtctgcagccagcctgctcga
aactttagtcggcctgatggcttagaggactctgaggatagcaaagaagatgagaatgtg
cctactgctcctgatcctccaagtcaacatttacgtgggcatgggacaggcttttgcttt
gattccagctttgatgttcacaagaagtgtcccctctgtgagttaatgtttcctcctaac
tatgatcagagcaaatttgaagaacatgttgaaagtcactggaaggtgtgcccgatgtgc
agcgagcagttccctcctgactatgaccagcaggtgtttgaaaggcatgtgcagacccat
tttgatcagaatgttctaaattttgactag

DBGET integrated database retrieval system