KEGG   Homo sapiens (human): 8890Help
Entry
8890              CDS       T01001                                 

Gene name
EIF2B4, EIF-2B, EIF2B, EIF2Bdelta
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit delta
  KO
K03680  translation initiation factor eIF-2B subunit delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05168  Herpes simplex virus 1 infection
Network
nt06138  PKR-eIF2alpha signaling (virus)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
  Element
N00571  PKR-eIF2alpha signaling pathway
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
Disease
H00869  Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8890 (EIF2B4)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex virus 1 infection
    8890 (EIF2B4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    8890 (EIF2B4)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-2B
    8890 (EIF2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF-2B DUF3819
Motif
Other DBs
NCBI-GeneID: 8890
NCBI-ProteinID: NP_001029288
OMIM: 606687
HGNC: 3260
Ensembl: ENSG00000115211
Vega: OTTHUMG00000151927
Pharos: Q9UI10(Tbio)
UniProt: Q9UI10
Structure
PDB: 

Position
2p23.3
AA seq 523 aa AA seqDB search
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtggccgtggctgttcgcgaggactcgggatccgggatgaaggcggagctt
ccccctgggcctggggcagtggggagggaaatgaccaaagaagaaaagctgcagcttcgg
aaggaaaagaaacagcagaagaagaaacggaaggaagaaaagggggcagaaccagagact
ggctctgctgtatctgcagcccaatgtcaagtaggcccaaccagagaactgccagaatcg
ggcattcagttgggcactcctcgggagaaagttccagctggtcggagtaaggccgaactt
cgggctgagcgtcgagccaagcaggaggccgagcgggccctgaaacaggcaagaaaaggg
gaacaaggaggaccacctcctaaggccagccccagcacagctggagaaaccccctcagga
gtgaagcgtctccctgagtaccctcaggttgatgacctacttctgagaaggcttgttaaa
aaaccagagcgtcaacaggttcctacacgaaaggattatggatccaaagtcagtctcttc
tctcacctaccccagtacagcagacaaaactctctgacccagtttatgagcatcccatcc
tctgtgatccacccagccatggtgcgactcggcctgcagtactcccagggcctggtcagt
ggctccaatgcccggtgtattgccctgcttcgtgccttgcagcaggtgattcaggattac
acaacaccgcctaatgaagaactctccagggatctagtgaataaactaaaaccctacatg
agcttcctgactcagtgccgtcccctgtcagcgagcatgcacaacgccatcaagttcctt
aacaaggaaatcaccagtgtgggcagttccaagcgggaagaggaggccaagtcagaactt
cgagcagccattgatcggtatgtgcaagagaagattgtgctagcagctcaggcaatttca
cgctttgcttaccagaagatcagtaatggagatgtgatcctggtatatggatgctcatct
ctggtatcacgaattcttcaggaggcttggacagagggccggcggtttcgggtggtagtg
gtggacagccggccatggctggaaggaaggcacacactacgttctctagtccatgctggt
gtcccagcctcctacctgctgattcctgcagcctcctatgtgctcccagaggtttccaag
gtgctattgggagctcatgcactcttggccaacgggtctgtgatgtcacgggtagggaca
gcacagttagccctggtggctcgagcccataatgtaccagtgctggtttgctgtgaaaca
tacaagttctgtgagcgtgtgcagactgatgcctttgtctctaatgagctagatgaccct
gatgatctgcaatgtaagcggggagaacatgttgcgctggctaactggcagaaccacgca
tccctacggttgttgaatctagtctatgatgtgactcccccagagcttgtggatctggtg
atcacggagctggggatgatcccttgcagttctgtacctgttgttctacgagtcaagagc
agtgaccagtga

DBGET integrated database retrieval system