KEGG   Homo sapiens (human): 8891Help
Entry
8891              CDS       T01001                                 

Gene name
EIF2B3, EIF-2B, EIF2Bgamma
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit gamma
  KO
K03241  translation initiation factor eIF-2B subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05168  Herpes simplex virus 1 infection
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
  Element
N00571  PKR-eIF2alpha signaling pathway
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
Disease
H00869  Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8891 (EIF2B3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    8891 (EIF2B3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    8891 (EIF2B3)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    8891 (EIF2B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DUF4954 Hexapep CTP_transf_3 Fucokinase
Motif
Other DBs
NCBI-GeneID: 8891
NCBI-ProteinID: NP_065098
OMIM: 606273
HGNC: 3259
Ensembl: ENSG00000070785
Vega: OTTHUMG00000008585
Pharos: Q9NR50(Tbio)
UniProt: Q9NR50 Q9HA31
Structure
PDB: 

Position
1p34.1
AA seq 452 aa AA seqDB search
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggaatttcaagcagtagtgatggcagtaggtggaggatctcggatgacagacctaact
tccagcattcccaaacctctgcttccagttgggaacaaacctttaatttggtacccattg
aacctgcttgagcgtgttggatttgaagaagtcattgtggttacaaccagggatgttcaa
aaggctctatgtgcagaattcaagatgaaaatgaagccagatattgtgtgtattcctgat
gacgctgacatgggaactgcagattctttgcgctacatatatccaaaacttaagacagat
gtgctggtgctgagctgtgatctgataacagacgttgccttacatgaggttgtggacctg
tttagagcttatgatgcatcacttgctatgttgatgagaaaaggccaagatagcatagaa
cctgttcccggtcaaaaggggaaaaaaaaagcagtggagcagcgtgacttcattggagtg
gacagcacaggaaagaggctgctcttcatggctaatgaagcagacttggatgaagagctg
gtcattaagggatccatcctacagaagcatcctagaatacgtttccacacgggtcttgtg
gatgcccacctctactgtttgaaaaaatacatcgtggatttcctaatggaaaatgggtca
ataacttctatccggagtgaactgattccatatttagtgagaaaacagttttcctcagct
tcctcacaacagggacaagaagaaaaagaggaggatctaaagaaaaaggagctgaagtcc
ttagatatctacagttttataaaagaagccaatacactgaacctggctccctatgatgcc
tgctggaatgcctgtcgaggagacaggtgggaagacttgtccagatcacaggtgcgctgc
tatgtccacatcatgaaagaggggctctgctctcgagtgagcacactgggactctacatg
gaagcaaacagacaggtgcccaaattgctgtctgctctctgtccagaagaaccaccagtc
cattcgtcagcccagattgtcagcaaacacctggttggagttgacagcctcattgggcca
gagacacagattggagagaagtcatccattaagcgctcagtcattggctcatcctgtctc
ataaaagatagagtgactattaccaattgccttctcatgaactcagtcactgtggaggaa
ggaagcaatatccaaggcagtgtcatctgcaacaatgctgtgatcgagaagggtgcagac
atcaaggactgcttgattggaagtggccagaggattgaagccaaagctaaacgagtgaat
gaggtgatcgtggggaatgaccagctcatggagatctga

DBGET integrated database retrieval system