KEGG   Homo sapiens (human): 8892Help
Entry
8892              CDS       T01001                                 

Gene name
EIF2B2, EIF-2Bbeta, EIF2B
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit beta
  KO
K03754  translation initiation factor eIF-2B subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05168  Herpes simplex virus 1 infection
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
  Element
N00571  PKR-eIF2alpha signaling pathway
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
Disease
H00869  Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8892 (EIF2B2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    8892 (EIF2B2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    8892 (EIF2B2)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    8892 (EIF2B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF-2B DUF4055 MSC
Motif
Other DBs
NCBI-GeneID: 8892
NCBI-ProteinID: NP_055054
OMIM: 606454
HGNC: 3258
Ensembl: ENSG00000119718
Vega: OTTHUMG00000171764
Pharos: P49770(Tbio)
UniProt: P49770 Q53XC2
Structure
PDB: 

Position
14q24.3
AA seq 351 aa AA seqDB search
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgggatccgcagcgaagggctcggagttgtcagagaggatcgagagcttcgtggag
accctgaagcggggtggtgggccgcgcagctccgaggaaatggctcgggagaccctaggg
ttgctgcgccagatcatcacggaccaccgctggagcaacgcgggggagctgatggagctg
atccgcagagagggcaggaggatgacggccgctcagccctccgagaccaccgtgggcaac
atggtgcggagagtgctcaagattatccgggaggagtatggcagactccatggacgcagc
gacgagagtgatcagcaggagtccctgcacaaactgttgacatccggaggcctaaacgag
gatttcagcttccattatgcccaactccagtccaacatcattgaggcgattaatgagctg
ctagtggagctggaagggacaatggagaacattgcagcccaggctctggagcacattcac
tccaatgaggtgatcatgaccattggcttctcccgaacagtagaggccttcctcaaagag
gctgcccgaaagaggaaattccatgtcattgtagcagagtgtgctcctttctgccagggt
catgaaatggctgtgaatttgtccaaagcaggtattgagacaactgtcatgactgatgct
gccatttttgccgttatgtcaagagtcaacaaggtgatcattggcacgaagaccatcctg
gccaatggggccctgagagctgtgacaggaactcacactctggcactggcagcaaaacac
cattccaccccactcatcgtctgtgcacctatgttcaaactttctccacagttccccaat
gaagaagactcatttcataagtttgtggctcctgaagaagtcctgccattcacagaaggg
gacattctggagaaggtcagcgtgcattgccctgtgtttgactacgttcccccagagctc
attaccctctttatctccaacattggtgggaatgcaccttcctacatctaccgcctgatg
agtgaactctaccatcctgatgatcatgttttatga

DBGET integrated database retrieval system