KEGG   Homo sapiens (human): 8893Help
Entry
8893              CDS       T01001                                 

Gene name
EIF2B5, CACH, CLE, EIF-2B, EIF2Bepsilon, LVWM
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit epsilon
  KO
K03240  translation initiation factor eIF-2B subunit epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05168  Herpes simplex virus 1 infection
Network
nt06138  PKR-eIF2alpha signaling (virus)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
  Element
N00571  PKR-eIF2alpha signaling pathway
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
Disease
H00869  Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8893 (EIF2B5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    8893 (EIF2B5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    8893 (EIF2B5)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-2B
    8893 (EIF2B5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: W2 Hexapep DUF4954 Fucokinase Hexapep_2
Motif
Other DBs
NCBI-GeneID: 8893
NCBI-ProteinID: NP_003898
OMIM: 603945
HGNC: 3261
Ensembl: ENSG00000145191
Vega: OTTHUMG00000156840
Pharos: Q13144(Tbio)
UniProt: Q13144
Structure
PDB: 

Position
3q27.1
AA seq 721 aa AA seqDB search
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccctgtagtggcgccgcctggtgtggtggttagtcgggctaacaagcgcagc
ggcgcggggccgggaggcagcggtggcgggggagccagaggggcggaggaggaaccgccg
ccgcccctacaagcagttctggtggccgatagcttcgatcgccgcttcttccccatctcc
aaggaccagcctcgggtcctcttgcccctggccaatgtggcattaattgactacactctg
gaattcctgactgccacaggtgtacaggaaacatttgtcttttgttgctggaaagctgct
caaatcaaagaacatttactgaagtcaaagtggtgccgccctacatctctcaatgtggtt
cgaataattacatcagagctctatcgatcactgggagatgtcctccgtgatgttgatgcc
aaggctttggtgcgctctgactttcttctggtgtatggggatgtcatctcaaacatcaat
atcaccagagcccttgaggaacacaggttgagacggaagctagaaaaaaatgtttctgtg
atgacgatgatcttcaaggagtcatcccccagccacccaactcgttgccacgaagacaat
gtggtagtggctgtggatagtaccacaaacagggttctccattttcagaagacccagggt
ctccggcgttttgcatttcctctgagcctgtttcagggcagtagtgatggagtggaggtt
cgatatgatttactggattgtcatatcagcatctgttctcctcaggtggcacaactcttt
acagacaactttgactaccaaactcgagatgactttgtgcgaggtctcttagtgaatgag
gagatcctagggaaccagatccacatgcacgtaacagctaaggaatatggtgcccgtgtc
tccaacctacacatgtactcagctgtctgtgctgacgtcatccgccgatgggtctaccct
ctcaccccagaggcgaacttcactgacagcaccacccagagctgcactcattcccggcac
aacatctaccgagggcctgaggtcagcctgggccatggcagcatcctagaggaaaatgtg
ctcctgggctctggcactgtcattggcagcaattgctttatcaccaacagtgtcattggc
cccggctgccacattggtgataacgtggtgctggaccagacctacctgtggcagggtgtt
cgagtggcggctggagcacagatccatcagtctctgctttgtgacaatgctgaggtcaag
gaacgagtgacactgaaaccacgctctgtcctcacttcccaggtggtcgtgggcccaaat
atcacgctgcctgagggctcggtgatctctttgcaccctccagatgcagaggaagatgaa
gatgatggcgagttcagtgatgattctggggctgaccaagaaaaggacaaagtgaagatg
aaaggttacaatccagcagaagtaggagctgctggcaagggctacctctggaaagctgca
ggcatgaacatggaggaagaggaggaactgcagcagaatctgtggggactcaagatcaac
atggaagaagagagtgaaagtgaaagtgagcaaagtatggattctgaggagccggacagc
cggggaggctcccctcagatggatgacatcaaagtgttccagaatgaagttttaggaaca
ctacagcggggcaaagaggagaacatttcttgtgacaatctcgtcctggaaatcaactct
ctcaagtatgcctataacataagtctaaaggaggtgatgcaggtactgagccacgtggtc
ctggagttccccctgcaacagatggattccccgcttgactcaagccgctactgtgccctg
ctgcttcctctgctaaaggcctggagccctgtttttaggaactacataaagcgcgcagcc
gaccatttggaagcgttagcagccattgaggacttcttcctagagcatgaagctcttggt
atttccatggccaaggtactgatggctttctaccagctggagatcctggctgaggaaaca
attctgagctggttcagccaaagagatacaactgacaagggccagcagttgcgcaagaat
caacagctgcagaggttcatccagtggctaaaagaggcagaagaggagtcatctgaagat
gactga

DBGET integrated database retrieval system