KEGG   Homo sapiens (human): 8896
Entry
8896              CDS       T01001                                 

Gene name
BUD31, Cwc14, EDG-2, EDG2, G10, YCR063W, fSAP17
Definition
(RefSeq) BUD31 homolog
  KO
K12873  bud site selection protein 31
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8896 (BUD31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    8896 (BUD31)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    8896 (BUD31)
 Complex C
    8896 (BUD31)
SSDB
Motif
Pfam: G10
Other DBs
NCBI-GeneID: 8896
NCBI-ProteinID: NP_003901
OMIM: 603477
HGNC: 29629
Ensembl: ENSG00000106245
Vega: OTTHUMG00000154602
Pharos: P41223(Tbio)
UniProt: P41223
Structure
PDB: 

Position
7q22.1
AA seq 144 aa
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYI
FDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR
VPKSKLEVGRIIECTHCGCRGCSG
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcctaaagtcaaaagaagccggaaagcacccccagatggctgggagttgattgagcca
acactggatgaattagatcaaaagatgagagaagctgaaacagaaccgcatgagggaaag
aggaaagtggaatctctgtggcccatcttcaggatccaccaccagaaaacccgctacatc
ttcgacctcttttacaagcggaaagccatcagcagagaactctatgaatattgtattaaa
gaaggctatgcagacaaaaacctgattgcaaaatggaaaaagcaaggatatgagaacttg
tgctgcctgcggtgcattcagacacgggacaccaacttcgggacgaactgcatctgccgc
gtgcccaaaagcaagctggaagtgggccgcatcatcgagtgcacacactgtggctgtcgt
ggctgctctggctga

DBGET integrated database retrieval system