KEGG   Homo sapiens (human): 890Help
Entry
890               CDS       T01001                                 

Gene name
CCNA2, CCN1, CCNA
Definition
(RefSeq) cyclin A2
  KO
K06627  cyclin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04152  AMPK signaling pathway
hsa04218  Cellular senescence
hsa04914  Progesterone-mediated oocyte maturation
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05221  Acute myeloid leukemia
Network
nt06130  Cell cycle (viruses)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
  Element
N00091  p27-Cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00482  EBV EBNA3C to p27-Cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    890 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    890 (CCNA2)
   04218 Cellular senescence
    890 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    890 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    890 (CCNA2)
   05202 Transcriptional misregulation in cancer
    890 (CCNA2)
   05203 Viral carcinogenesis
    890 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    890 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    890 (CCNA2)
   05161 Hepatitis B
    890 (CCNA2)
   05169 Epstein-Barr virus infection
    890 (CCNA2)
   05165 Human papillomavirus infection
    890 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    890 (CCNA2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    890 (CCNA2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    890 (CCNA2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    890 (CCNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C Sororin
Motif
Other DBs
NCBI-GeneID: 890
NCBI-ProteinID: NP_001228
OMIM: 123835
HGNC: 1578
Ensembl: ENSG00000145386
Vega: OTTHUMG00000133072
Pharos: P20248(Tchem)
UniProt: P20248
Structure
PDB: 

Position
4q27
AA seq 432 aa AA seqDB search
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI
EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcaactctgcgccggggcctgcgacccgcgaggcgggctcggcgctgctagca
ttgcagcagacggcgctccaagaggaccaggagaatatcaacccggaaaaggcagcgccc
gtccaacaaccgcggacccgggccgcgctggcggtactgaagtccgggaacccgcggggt
ctagcgcagcagcagaggccgaagacgagacgggttgcaccccttaaggatcttcctgta
aatgatgagcatgtcaccgttcctccttggaaagcaaacagtaaacagcctgcgttcacc
attcatgtggatgaagcagaaaaagaagctcagaagaagccagctgaatctcaaaaaata
gagcgtgaagatgccctggcttttaattcagccattagtttacctggacccagaaaacca
ttggtccctcttgattatccaatggatggtagttttgagtcaccacatactatggacatg
tcaattatattagaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgag
gatattcacacataccttagggaaatggaggttaaatgtaaacctaaagtgggttacatg
aagaaacagccagacatcactaacagtatgagagctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggttcctgtcttccatgtcagtgctgagaggaaaacttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtac
attacagatgatacctacaccaagaaacaagttctgagaatggagcatctagttttgaaa
gtccttacttttgacttagctgctccaacagtaaatcagtttcttacccaatactttctg
catcagcagcctgcaaactgcaaagttgaaagtttagcaatgtttttgggagaattaagt
ttgatagatgctgacccatacctcaagtatttgccatcagttattgctggagctgccttt
catttagcactctacacagtcacgggacaaagctggcctgaatcattaatacgaaagact
ggatataccctggaaagtcttaagccttgtctcatggaccttcaccagacctacctcaaa
gcaccacagcatgcacaacagtcaataagagaaaagtacaaaaattcaaagtatcatggt
gtttctctcctcaacccaccagagacactaaatctgtaa

DBGET integrated database retrieval system