KEGG   Homo sapiens (human): 8905Help
Entry
8905              CDS       T01001                                 

Gene name
AP1S2, DC22, MRX59, MRXS21, MRXS5, MRXSF, PGS, SIGMA1B
Definition
(RefSeq) adaptor related protein complex 1 subunit sigma 2
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    8905 (AP1S2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8905 (AP1S2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8905 (AP1S2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    8905 (AP1S2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s DUF629 PulA_N1
Motif
Other DBs
NCBI-GeneID: 8905
NCBI-ProteinID: NP_003907
OMIM: 300629
HGNC: 560
Ensembl: ENSG00000182287
Vega: OTTHUMG00000021186
Pharos: P56377(Tbio)
UniProt: P56377 Q549M9
Position
Xp22.2
AA seq 157 aa AA seqDB search
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKR
YASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGG
EVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttatgttgctttttagtcgtcagggaaagcttcgactgcaaaaatggtatgtc
ccactatcagacaaagagaagaaaaagatcacaagagaacttgttcagaccgttttagca
cggaaacctaaaatgtgcagcttccttgagtggcgagatctgaagattgtttacaaaaga
tatgctagtctgtatttttgctgtgctattgaggatcaggacaatgaactaattaccctg
gaaataattcatcgttatgtggaattacttgacaagtatttcggcagtgtctgtgaacta
gatatcatctttaattttgagaaggcttattttattttggatgagtttcttttgggaggg
gaagttcaggaaacatccaagaaaaatgtccttaaagcaattgagcaggctgatctactg
caggaggaagctgaaaccccacgtagtgttcttgaagaaattggactgacataa

DBGET integrated database retrieval system