KEGG   Homo sapiens (human): 8906
Entry
8906              CDS       T01001                                 
Symbol
AP1G2, G2AD
Name
(RefSeq) adaptor related protein complex 1 subunit gamma 2
  KO
K12391  AP-1 complex subunit gamma-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    8906 (AP1G2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8906 (AP1G2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8906 (AP1G2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    8906 (AP1G2)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptinC2 Cnd1 DUF5609
Other DBs
NCBI-GeneID: 8906
NCBI-ProteinID: NP_003908
OMIM: 603534
HGNC: 556
Ensembl: ENSG00000213983
Pharos: O75843(Tbio)
UniProt: O75843
Structure
Position
14:complement(23559567..23567791)
AA seq 785 aa
MVVPSLKLQDLIEEIRGAKTQAQEREVIQKECAHIRASFRDGDPVHRHRQLAKLLYVHML
GYPAHFGQMECLKLIASSRFTDKRVGYLGAMLLLDERHDAHLLITNSIKNDLSQGIQPVQ
GLALCTLSTMGSAEMCRDLAPEVEKLLLQPSPYVRKKAILTAVHMIRKVPELSSVFLPPC
AQLLHERHHGILLGTITLITELCERSPAALRHFRKVVPQLVHILRTLVTMGYSTEHSISG
VSDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTDTSRNAGNAVLFETVLTIMDI
RSAAGLRVLAVNILGRFLLNSDRNIRYVALTSLLRLVQSDHSAVQRHRPTVVECLRETDA
SLSRRALELSLALVNSSNVRAMMQELQAFLESCPPDLRADCASGILLAAERFAPTKRWHI
DTILHVLTTAGTHVRDDAVANLTQLIGGAQELHAYSVRRLYNALAEDISQQPLVQVAAWC
IGEYGDLLLAGNCEEIEPLQVDEEEVLALLEKVLQSHMSLPATRGYALTALMKLSTRLCG
DNNRIRQVVSIYGSCLDVELQQRAVEYDTLFRKYDHMRAAILEKMPLVERDGPQADEEAK
ESKEAAQLSEAAPVPTEPQASQLLDLLDLLDGASGDVQHPPHLDPSPGGALVHLLDLPCV
PPPPAPIPDLKVFEREGVQLNLSFIRPPENPALLLITITATNFSEGDVTHFICQAAVPKS
LQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLP
VESWQ
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggtggtgccttcgctgaagcttcaggacctcatcgaagagattcgcggggccaagact
caggcccaggagcgggaggtgatccaaaaggagtgtgcccacatccgggcctccttccgc
gacggggacccagtgcacaggcaccggcagctggccaaactgctctacgtccacatgttg
ggctaccccgcccactttggacagatggagtgcctgaaactgatcgcctcctccagattc
acagacaagagggtgggctacctgggggccatgcttctattggatgagaggcacgatgcc
cacctgctcattaccaacagcatcaagaatgacctgagccaggggattcagccagtacaa
ggcctggccttgtgcactttgagcaccatgggctctgctgagatgtgccgagacctggcc
ccagaggtggagaaactgctcctgcagcccagtccctacgtgcgcaagaaggctattctg
actgcagtgcacatgatccggaaggtccctgaactctccagtgtcttcctcccaccctgt
gcccaactgcttcatgagcgtcaccatggcatcctgctgggcaccatcacgctgatcacg
gagctctgcgaacgaagccctgcagccctcaggcacttccgaaaggtggtaccccagctg
gtacacatcctccggactctggtgacaatgggatactccacagaacacagcatatctgga
gtcagcgaccccttcctgcaggtccagatacttcgtctgcttcggatcctgggccggaac
cacgaggagagcagtgagaccatgaatgacttgctggcccaggtggccactaacacggac
accagccgaaatgccggaaatgcggtcctgtttgagacagtactcaccatcatggatatc
cgctctgcagctggcctacgggttctagctgtcaacattcttggtcgcttcctactcaac
agtgacaggaacattaggtatgtagccctgacatcactgcttcgactggtgcagtctgat
cacagtgctgtgcagcggcatcggcccactgtggtggaatgtctacgggaaactgatgcc
tccctcagccggagagccctggaactaagcctggctctggtaaatagctccaatgtgcga
gccatgatgcaagagctgcaggcctttctggagtcctgccctcctgacctacgggctgac
tgtgcctcaggcatcctgctggctgcagagaggtttgctccaaccaaacgctggcacata
gacaccatcctgcatgtgctgacaacggcgggcacccatgtgcgggatgatgcagtggcc
aacctgacccagctgattgggggggcccaggagctacatgcctactctgtgcgccgcctc
tacaatgccctggcagaagacatttcccagcaaccactggtgcaggtggcagcctggtgc
attggggagtatggggacctcctgctggcagggaactgcgaggagattgagccccttcag
gtggacgaagaggaagtgctggcattgctggaaaaggtgctgcagtcccacatgtccctg
ccagccactcgaggatatgccctcacagccctcatgaagctcagcactcgcctctgtggg
gacaacaaccgcatccgccaggtggtgtccatctacgggagctgcttggacgtggagctg
cagcagcgggctgtggagtatgacacactcttccggaaatacgaccacatgagggctgcc
atcctggaaaaaatgcctcttgtggagcgagatggccctcaggctgatgaggaagcaaag
gaaagcaaagaagcagcccagctttcagaagcagccccagtgcccacagagccccaggcc
tcacagctcctggatctgctagatctcctggatggggcttctggggatgtccagcatcct
ccccatctggacccctccccaggaggtgccctggtacacctgcttgaccttccctgtgta
cctccacccccagctcccatcccagatctcaaagtgtttgagcgtgagggagtacagctg
aatctgtctttcattcgaccccctgaaaaccctgctttgctgttaatcaccatcactgcc
accaacttctcagagggtgatgtcacccatttcatctgccaggctgctgtgcccaagagt
ctccagctgcagctgcaggcccccagtgggaacacagttccagctcggggtggccttcct
atcacccagctcttcagaatcctcaatcctaacaaggcccccctgcggctaaagctgcgc
ctcacctacgaccactttcaccagtcggtgcaggagatctttgaggtgaacaacttgcct
gtggaatcgtggcagtaa

DBGET integrated database retrieval system