KEGG   Homo sapiens (human): 8907Help
Entry
8907              CDS       T01001                                 

Gene name
AP1M1, AP47, CLAPM2, CLTNM, MU-1A
Definition
(RefSeq) adaptor related protein complex 1 subunit mu 1
  KO
K12393  AP-1 complex subunit mu
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    8907 (AP1M1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    8907 (AP1M1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8907 (AP1M1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    8907 (AP1M1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adap_comp_sub Clat_adaptor_s DUF5482 muHD
Motif
Other DBs
NCBI-GeneID: 8907
NCBI-ProteinID: NP_115882
OMIM: 603535
HGNC: 13667
Ensembl: ENSG00000072958
Vega: OTTHUMG00000182323
Pharos: Q9BXS5(Tbio)
UniProt: Q9BXS5 A0A024R7K8 B3KNH5
Position
19p13.11
AA seq 423 aa AA seqDB search
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWI
KHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDF
GYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVN
LLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQ
CVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQ
FKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHF
GLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQL
RTQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccagcgccgtctacgtgctggacctgaagggcaaggtgctcatctgccggaac
taccgtggcgacgtggacatgtcagaggtggagcacttcatgcccatcctgatggagaag
gaggaggaggggatgctgtcgcccatcctggcccacgggggggtccgtttcatgtggatc
aaacacaacaacctgtatctggttgccacatccaagaagaacgcgtgcgtgtcgctggtc
ttttctttcctctataaggtggtgcaggtgttttccgagtacttcaaggagctggaggag
gagagcatccgggacaactttgttatcatctacgagctgctggacgagctcatggacttc
ggctacccccagaccaccgacagcaagatcctgcaggagtacatcactcaggaaggccac
aagctggaaacaggggccccgcggccaccagccaccgtcaccaacgcggtgtcctggcgg
tccgaaggcatcaagtatcggaagaatgaggtgttcttggacgtcatcgagtctgtcaac
ctcttggtcagcgccaacggcaatgtcctgcgcagcgagatcgtgggctccatcaagatg
cgagtcttcctctcgggcatgcccgagctgcgcctgggcctcaacgacaaggtcctcttt
gacaacacgggccgcggcaaaagcaaatccgtggagctggaggatgtgaagttccaccag
tgtgtgcggctatcacgcttcgagaatgaccgcaccatctccttcatcccacccgacggc
gagttcgagctcatgtcctaccgtctcaacacccacgtcaagcctttgatatggatcgag
tcggtgatcgagaagcactcccacagccgcatcgagtacatgatcaaggccaaaagccag
ttcaagcggcggtcaacagccaacaacgtggagatccacattcccgtgcccaatgatgcc
gactcacccaagttcaagacgacggtggggagcgttaagtgggtccccgagaacagcgag
atcgtgtggtccatcaagtccttcccgggcggcaaggagtacctgatgcgggcccacttc
ggcctgcctagtgtggaggccgaagacaaggagggcaagcccccgatcagtgtcaagttc
gagatcccttacttcactacctccggcatccaggtgcgctacctgaagatcattgagaag
agtgggtaccaggccctgccctgggtgcgttatatcacgcagaatggagattaccagctc
cggacccagtga

DBGET integrated database retrieval system