KEGG   Homo sapiens (human): 89122Help
Entry
89122             CDS       T01001                                 

Gene name
TRIM4, RNF87
Definition
(RefSeq) tripartite motif containing 4
  KO
K11998  tripartite motif-containing protein 4 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    89122 (TRIM4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     89122 (TRIM4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    89122 (TRIM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_4 zf-RING_UBOX zf-C3HC4 zf-C3HC4_2 zf-B_box SPRY PRY zf-C3HC4_3 zf-RING_2 zf-RING_5 zf-Nse Fasciclin zf-RING_10
Motif
Other DBs
NCBI-GeneID: 89122
NCBI-ProteinID: NP_148977
HGNC: 16275
Ensembl: ENSG00000146833
Vega: OTTHUMG00000156648
Pharos: Q9C037(Tdark)
UniProt: Q9C037
Position
7q22.1
AA seq 500 aa AA seqDB search
MEAEDIQEELTCPICLDYFQDPVSIECGHNFCRGCLHRNWAPGGGPFPCPECRHPSAPAA
LRPNWALARLTEKTQRRRLGPVPPGLCGRHWEPLRLFCEDDQRPVCLVCRESQEHQTHAM
APIDEAFESYRTGNFDIHVDEWKRRLIRLLLYHFKQEEKLLKSQRNLVAKMKKVMHLQDV
EVKNATQWKDKIKSQRMRISTEFSKLHNFLVEEEDLFLQRLNKEEEETKKKLNENTLKLN
QTIASLKKLILEVGEKSQAPTLELLQNPKEVLTRSEIQDVNYSLEAVKVKTVCQIPLMKE
MLKRFQVAVNLAEDTAHPKLVFSQEGRYVKNTASASSWPVFSSAWNYFAGWRNPQKTAFV
ERFQHLPCVLGKNVFTSGKHYWEVESRDSLEVAVGVCREDVMGITDRSKMSPDVGIWAIY
WSAAGYWPLIGFPGTPTQQEPALHRVGVYLDRGTGNVSFYSAVDGVHLHTFSCSSVSRLR
PFFWLSPLASLVIPPVTDRK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgaggacatccaggaggagttgacctgccccatctgcctggactatttccag
gacccggtgtccatcgagtgcggccacaacttctgccgcggctgcctgcaccgcaactgg
gcgccgggcggcggcccgttcccctgccccgaatgtcggcacccatcggcgcccgccgcg
ctgcgacccaactgggccctggccaggctgactgagaagacgcagcgccggcgcctgggc
cccgtgcccccgggcctgtgcggccgccactgggagccgctgcggctcttctgcgaggac
gaccagcggccagtgtgcctggtgtgcagggagtcccaggagcaccagactcacgccatg
gcacccatcgacgaggccttcgagagctaccggacaggtaactttgacatccacgtggat
gaatggaagagaagactaattaggctgctcttgtaccattttaagcaggaggagaaactt
cttaagtctcagcgtaatctcgtggccaagatgaagaaagtcatgcatttacaggatgta
gaagtgaagaacgccacacagtggaaggataagataaagagtcagcgaatgagaatcagc
acggagttttcaaagctgcacaacttcctggttgaagaagaggacctgtttcttcagaga
ttgaacaaagaagaagaagagacgaagaagaagctgaatgagaacacgttaaaactcaat
caaactatcgcttcattgaagaagctcatcttagaggtgggggagaagagccaggctccc
accctggagctgcttcagaatccaaaagaagtgttgaccaggagtgagatccaggatgtg
aactattctcttgaagctgtaaaggtgaagacagtgtgccagataccattgatgaaggaa
atgctaaagcgattccaagtggctgtaaacctagctgaagacacagctcatcccaaactc
gtcttctcccaggaagggagatacgtgaaaaatacagcatcagccagttcttggccagtg
ttttcttcagcatggaactactttgctggatggaggaatcctcagaagactgcttttgta
gagagatttcagcacttaccctgtgttctgggaaaaaacgttttcacctcagggaaacat
tactgggaagttgagagtagagatagtctggaggttgctgttggggtgtgtcgggaggac
gtcatgggaattactgatcgttcaaaaatgtccccagatgtgggcatctgggcgatttat
tggagtgctgctggctattggcccttgataggcttccctggaactcccacccagcaagag
ccagctctccaccgagtgggggtttacctggatcgtgggactgggaatgtctccttctac
agcgctgtggacggagtgcacctgcacaccttttcttgttcttctgtctcacgcctccgg
ccatttttttggttgagtccattagcatctttagtcattccaccagtgactgataggaaa
tga

DBGET integrated database retrieval system