KEGG   Homo sapiens (human): 8913Help
Entry
8913              CDS       T01001                                 

Gene name
CACNA1G, Ca(V)T.1, Cav3.1, NBR13, SCA42, SCA42ND
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 G
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04020  Calcium signaling pathway
hsa04713  Circadian entrainment
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04930  Type II diabetes mellitus
hsa04934  Cushing syndrome
Disease
H00063  Spinocerebellar ataxia (SCA)
Drug target
Bepridil (DG00333): D00631 D07520
Ethosuximide: D00539
Flunarizine (DG01006): D01303 D07971
Lomerizine hydrochloride: D02633
Mesuximide: D00404
Mibefradil (DG00328): D05024 D08217
Penfluridol: D02630
Valproic acid (DG00849): D00304 D00399 D00710 D08667
Zonisamide: D00538
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    8913 (CACNA1G)
   04020 Calcium signaling pathway
    8913 (CACNA1G)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    8913 (CACNA1G)
   04927 Cortisol synthesis and secretion
    8913 (CACNA1G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    8913 (CACNA1G)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    8913 (CACNA1G)
   04934 Cushing syndrome
    8913 (CACNA1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    8913 (CACNA1G)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   8913 (CACNA1G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel SieB
Motif
Other DBs
NCBI-GeneID: 8913
NCBI-ProteinID: NP_061496
OMIM: 604065
HGNC: 1394
Ensembl: ENSG00000006283
Vega: OTTHUMG00000162180
Pharos: O43497(Tclin)
UniProt: O43497
Position
17q21.33
AA seq 2377 aa AA seqDB search
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSS
SCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTP
ALSGAPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
TLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKADSG
ACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDA
EPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGDRKKCL
ALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA
HEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQ
DEEESSEEERASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCN
GKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFP
PQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAV
FLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVL
RLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFV
CQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVG
VDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRL
RRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGV
IGLNVVTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDL
AIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQAL
PQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVST
GDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKE
AKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASH
FSLEHPTDRQLFDTISLLIQGSLEWELKLMDELAGPGGQPSAFPSAPSLGGSDPQIPLAE
MEALSLTSEIVSEPSCSLALTDDSLPDDMHTLLLSALESNMQPHPTELPGPDLLTVRKSG
VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAP
HLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLAEVSGPS
PPLARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGPEPNWGKGPPETRSSLELDTE
LSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQ
PHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDS
KDPLASGPPDSMAASPSPKKDVLSLSGLSSDPADLDP
NT seq 7134 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggaggaggatggagcgggcgccgaggagtcgggacagccccggagcttcatg
cggctcaacgacctgtcgggggccgggggccggccggggccggggtcagcagaaaaggac
ccgggcagcgcggactccgaggcggaggggctgccgtacccggcgctggccccggtggtt
ttcttctacttgagccaggacagccgcccgcggagctggtgtctccgcacggtctgtaac
ccctggtttgagcgcatcagcatgttggtcatccttctcaactgcgtgaccctgggcatg
ttccggccatgcgaggacatcgcctgtgactcccagcgctgccggatcctgcaggccttt
gatgacttcatctttgccttctttgccgtggagatggtggtgaagatggtggccttgggc
atctttgggaaaaagtgttacctgggagacacttggaaccggcttgactttttcatcgtc
atcgcagggatgctggagtactcgctggacctgcagaacgtcagcttctcagctgtcagg
acagtccgtgtgctgcgaccgctcagggccattaaccgggtgcccagcatgcgcatcctt
gtcacgttgctgctggatacgctgcccatgctgggcaacgtcctgctgctctgcttcttc
gtcttcttcatcttcggcatcgtcggcgtccagctgtgggcagggctgcttcggaaccga
tgcttcctacctgagaatttcagcctccccctgagcgtggacctggagcgctattaccag
acagagaacgaggatgagagccccttcatctgctcccagccacgcgagaacggcatgcgg
tcctgcagaagcgtgcccacgctgcgcggggacgggggcggtggcccaccttgcggtctg
gactatgaggcctacaacagctccagcaacaccacctgtgtcaactggaaccagtactac
accaactgctcagcgggggagcacaaccccttcaagggcgccatcaactttgacaacatt
ggctatgcctggatcgccatcttccaggtcatcacgctggagggctgggtcgacatcatg
tactttgtgatggatgctcattccttctacaatttcatctacttcatcctcctcatcatc
gtgggctccttcttcatgatcaacctgtgcctggtggtgattgccacgcagttctcagag
accaagcagcgggaaagccagctgatgcgggagcagcgtgtgcggttcctgtccaacgcc
agcaccctggctagcttctctgagcccggcagctgctatgaggagctgctcaagtacctg
gtgtacatccttcgtaaggcagcccgcaggctggctcaggtctctcgggcagcaggtgtg
cgggttgggctgctcagcagcccagcacccctcgggggccaggagacccagcccagcagc
agctgctctcgctcccaccgccgcctatccgtccaccacctggtgcaccaccaccaccac
catcaccaccactaccacctgggcaatgggacgctcagggccccccgggccagcccggag
atccaggacagggatgccaatgggtcccgccggctcatgctgccaccaccctcgacgcct
gccctctccggggccccccctggtggcgcagagtctgtgcacagcttctaccatgccgac
tgccacttagagccagtccgctgccaggcgccccctcccaggtccccatctgaggcatcc
ggcaggactgtgggcagcgggaaggtgtatcccaccgtgcacaccagccctccaccggag
acgctgaaggagaaggcactagtagaggtggctgccagctctgggcccccaaccctcacc
agcctcaacatcccacccgggccctacagctccatgcacaagctgctggagacacagagt
acaggtgcctgccaaagctcttgcaagatctccagcccttgcttgaaagcagacagtgga
gcctgtggtccagacagctgcccctactgtgcccgggccggggcaggggaggtggagctc
gccgaccgtgaaatgcctgactcagacagcgaggcagtttatgagttcacacaggatgcc
cagcacagcgacctccgggacccccacagccggcggcaacggagcctgggcccagatgca
gagcccagctctgtgctggccttctggaggctaatctgtgacaccttccgaaagattgtg
gacagcaagtactttggccggggaatcatgatcgccatcctggtcaacacactcagcatg
ggcatcgaataccacgagcagcccgaggagcttaccaacgccctagaaatcagcaacatc
gtcttcaccagcctctttgccctggagatgctgctgaagctgcttgtgtatggtcccttt
ggctacatcaagaatccctacaacatcttcgatggtgtcattgtggtcatcagcgtgtgg
gagatcgtgggccagcaggggggcggcctgtcggtgctgcggaccttccgcctgatgcgt
gtgctgaagctggtgcgcttcctgccggcgctgcagcggcagctggtggtgctcatgaag
accatggacaacgtggccaccttctgcatgctgcttatgctcttcatcttcatcttcagc
atcctgggcatgcatctcttcggctgcaagtttgcctctgagcgggatggggacaccctg
ccagaccggaagaattttgactccttgctctgggccatcgtcactgtctttcagatcctg
acccaggaggactggaacaaagtcctctacaatggtatggcctccacgtcgtcctgggcg
gccctttatttcattgccctcatgaccttcggcaactacgtgctcttcaatttgctggtc
gccattctggtggagggcttccaggcggaggaaatcagcaaacgggaagatgcgagtgga
cagttaagctgtattcagctgcctgtcgactcccaggggggagatgccaacaagtccgaa
tcagagcccgatttcttctcacccagcctggatggtgatggggacaggaagaagtgcttg
gccttggtgtccctgggagagcacccggagctgcggaagagcctgctgccgcctctcatc
atccacacggccgccacacccatgtcgctgcccaagagcaccagcacgggcctgggcgag
gcgctgggccctgcgtcgcgccgcaccagcagcagcgggtcggcagagcctggggcggcc
cacgagatgaagtcaccgcccagcgcccgcagctctccgcacagcccctggagcgctgca
agcagctggaccagcaggcgctccagccggaacagcctcggccgtgcacccagcctgaag
cggagaagcccaagtggagagcggcggtccctgttgtcgggagaaggccaggagagccag
gatgaagaggagagctcagaagaggagcgggccagccctgcgggcagtgaccatcgccac
agggggtccctggagcgggaggccaagagttcctttgacctgccagacacactgcaggtg
ccagggctgcatcgcactgccagtggccgagggtctgcttctgagcaccaggactgcaat
ggcaagtcggcttcagggcgcctggcccgggccctgcggcctgatgaccccccactggat
ggggatgacgccgatgacgagggcaacctgagcaaaggggaacgggtccgcgcgtggatc
cgagcccgactccctgcctgctgcctcgagcgagactcctggtcagcctacatcttccct
cctcagtccaggttccgcctcctgtgtcaccggatcatcacccacaagatgttcgaccac
gtggtccttgtcatcatcttccttaactgcatcaccatcgccatggagcgccccaaaatt
gacccccacagcgctgaacgcatcttcctgaccctctccaattacatcttcaccgcagtc
tttctggctgaaatgacagtgaaggtggtggcactgggctggtgcttcggggagcaggcg
tacctgcggagcagttggaacgtgctggacgggctgttggtgctcatctccgtcatcgac
attctggtgtccatggtctctgacagcggcaccaagatcctgggcatgctgagggtgctg
cggctgctgcggaccctgcgcccgctcagggtgatcagccgggcgcaggggctgaagctg
gtggtggagacgctgatgtcctcactgaaacccatcggcaacattgtagtcatctgctgt
gccttcttcatcattttcggcatcttgggggtgcagctcttcaaagggaagtttttcgtg
tgccagggcgaggataccaggaacatcaccaataaatcggactgtgccgaggccagttac
cggtgggtccggcacaagtacaactttgacaaccttggccaggccctgatgtccctgttc
gttttggcctccaaggatggttgggtggacatcatgtacgatgggctggatgctgtgggc
gtggaccagcagcccatcatgaaccacaacccctggatgctgctgtacttcatctcgttc
ctgctcattgtggccttctttgtcctgaacatgtttgtgggtgtggtggtggagaacttc
cacaagtgtcggcagcaccaggaggaagaggaggcccggcggcgggaggagaagcgccta
cgaagactggagaaaaagagaaggaatctaatgctggacgatgtaattgcttccggcagc
tcagccagcgctgcgtcagaagcccagtgcaaaccttactactccgactactcccgcttc
cggctcctcgtccaccacttgtgcaccagccactacctggacctcttcatcacaggtgtc
atcgggctgaacgtggtcaccatggccatggagcactaccagcagccccagattctggat
gaggctctgaagatctgcaactacatcttcactgtcatctttgtcttggagtcagttttc
aaacttgtggcctttggtttccgtcggttcttccaggacaggtggaaccagctggacctg
gccattgtgctgctgtccatcatgggcatcacgctggaggaaatcgaggtcaacgcctcg
ctgcccatcaaccccaccatcatccgcatcatgagggtgctgcgcattgcccgagtgctg
aagctgctgaagatggctgtgggcatgcgggcgctgctggacacggtgatgcaggccctg
ccccaggtggggaacctgggacttctcttcatgttgttgtttttcatctttgcagctctg
ggcgtggagctctttggagacctggagtgtgacgagacacacccctgtgagggcctgggc
cgtcatgccacctttcggaactttggcatggccttcctaaccctcttccgagtctccaca
ggtgacaattggaatggcattatgaaggacaccctccgggactgtgaccaggagtccacc
tgctacaacacggtcatctcgcctatctactttgtgtccttcgtgctgacggcccagttc
gtgctagtcaacgtggtgatcgccgtgctgatgaagcacctggaggagagcaacaaggag
gccaaggaggaggccgagctagaggctgagctggagctggagatgaagaccctcagcccc
cagccccactcgccactgggcagccccttcctctggcctggggtcgagggccccgacagc
cccgacagccccaagcctggggctctgcacccagcggcccacgcgagatcagcctcccac
ttttccctggagcaccccacggacaggcagctgtttgacaccatatccctgctgatccag
ggctccctggagtgggagctgaagctgatggacgagctggcaggcccagggggccagccc
tctgccttcccttctgcccccagcctgggaggctccgacccacagatccctctagctgag
atggaggctctgtctctgacgtcagagattgtgtctgaaccgtcctgctctctagctctg
acggatgactctttgcctgatgacatgcacacactcttacttagtgccctggagagcaat
atgcagccccaccccacggagctgccaggaccagacttactgactgtgcggaagtctggg
gtcagccgaacgcactctctgcccaatgacagctacatgtgtcggcatgggagcactgcc
gaggggcccctgggacacaggggctgggggctccccaaagctcagtcaggctccgtcttg
tccgttcactcccagccagcagataccagctacatcctgcagcttcccaaagatgcacct
catctgctccagccccacagcgccccaacctggggcaccatccccaaactgcccccacca
ggacgctcccctttggctcagaggccactcaggcgccaggcagcaataaggactgactcc
ttggacgttcagggtctgggcagccgggaagacctgctggcagaggtgagtgggccctcc
ccgcccctggcccgggcctactctttctggggccagtcaagtacccaggcacagcagcac
tcccgcagccacagcaagatctccaagcacatgaccccgccagccccttgcccaggccca
gaacccaactggggcaagggccctccagagaccagaagcagcttagagttggacacggag
ctgagctggatttcaggagacctcctgccccctggcggccaggaggagcccccatcccca
cgggacctgaagaagtgctacagcgtggaggcccagagctgccagcgccggcctacgtcc
tggctggatgagcagaggagacactctatcgccgtcagctgcctggacagcggctcccaa
ccccacctgggcacagacccctctaaccttgggggccagcctcttggggggcctgggagc
cggcccaagaaaaaactcagcccgcctagtatcaccatagacccccccgagagccaaggt
cctcggaccccgcccagccctggtatctgcctccggaggagggctccgtccagcgactcc
aaggatcccttggcctctggcccccctgacagcatggctgcctcgccctccccaaagaaa
gatgtgctgagtctctccggtttatcctctgacccagcagacctggacccctga

DBGET integrated database retrieval system