KEGG   Homo sapiens (human): 8914Help
Entry
8914              CDS       T01001                                 

Gene name
TIMELESS, TIM, TIM1, hTIM
Definition
(RefSeq) timeless circadian regulator
  KO
K03155  timeless
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8914 (TIMELESS)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   FPC (fork protection complex)
    8914 (TIMELESS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMELESS_C TIMELESS HTH_32 Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 8914
NCBI-ProteinID: NP_003911
OMIM: 603887
HGNC: 11813
Ensembl: ENSG00000111602
Vega: OTTHUMG00000170600
Pharos: Q9UNS1(Tbio)
UniProt: Q9UNS1
Structure
PDB: 

Position
12q13.3
AA seq 1208 aa AA seqDB search
MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQI
LQSDLLPILTQHHQDKPLFDAVIRLMVNLTQPALLCFGNLPKEPSFRHHFLQVLTYLQAY
KEAFASEKAFGVLSETLYELLQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKKID
DDASAHDQLLWAIHLSGLDDLLLFLASSSAEEQWSLHVLEIVSLMFRDQNPEQLAGVGQG
RLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGGSYIVQGLKSIGERDLIFHKG
LHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVRLFLRDFCSEFLENCYNRLMGS
VKDHLLREKAQQHDETYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYE
MMLTDRKEAASWARRMHLALKAYQELLATVNEMDISPDEAVRESSRIIKNNIFYVMEYRE
LFLALFRKFDERCQPRSFLRDLVETTHLFLKMLERFCRSRGNLVVQNKQKKRRKKKKKVL
DQAIVSGNVPSSPEEVEAVWPALAEQLQCCAQNSELSMDSVVPFDAASEVPVEEQRAEAM
VRIQDCLLAGQAPQALTLLRSAREVWPEGDVFGSQDISPEEEIQLLKQILSAPLPRQQGP
EERGAEEEEEEEEEEEEELQVVQVSEKEFNFLDYLKRFACSTVVRAYVLLLRSYQQNSAH
TNHCIVKMLHRLAHDLKMEALLFQLSVFCLFNRLLSDPAAGAYKELVTFAKYILGKFFAL
AAVNQKAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLRELYLANKDV
EGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQRL
FEEFRDSDDVLGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKRQKKLASSILPNGA
ESLKDFCQEDLEEEENLPEEDSEEEEEGGSEAEQVQGSLVLSNENLGQSLHQEGFSIPLL
WLQNCLIRAADDREEDGCSQAVPLVPLTEENEEAMENEQFQQLLRKLGVRPPASGQETFW
RIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQGSDEEHCKEHRAQALRALLLA
HKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRY
QIEDDEDD
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atggacttgcacatgatgaactgtgaacttctagccacatgtagtgcccttgggtacttg
gagggagacacttaccataaggaaccagattgcttagagagcgtgaaggatctgatccgc
tatttgaggcatgaggatgagacacgagatgtgcggcagcagctgggggcagcccagatc
ctacagagcgaccttctgcccatcctcacccagcaccaccaggacaagcctctctttgat
gctgttatcagactgatggtgaacttgacacaaccagccttgctctgttttggcaatctg
cctaaggagcccagctttcggcaccattttttgcaggtgctaacttatttgcaggcctac
aaagaggcctttgccagtgagaaggcttttggagtcctcagtgaaaccttgtatgagctg
ctgcagctgggctgggaggaacggcaggaggaagacaacttgctgattgaacggatccta
ctgctggtcagaaatattctccatgtcccagctgaccttgatcaggagaagaagattgat
gatgacgccagtgcccatgaccagctcctctgggcgattcacctcagcggcctggatgac
ctgctcctctttctggccagctcgtctgctgaggagcaatggagcctacatgtgctagag
attgtctcccttatgtttcgtgaccagaaccccgagcagctggcgggagtagggcaggga
cgcttagctcaggagcggagtgcagattttgcagaactggaggtgttgcgccagcgagag
atggcagaaaagaagactcgagccctccagcgaggcaacaggcattctcgatttgggggc
tcctatattgtccaggggttgaaatccattggggagagggacctcatctttcacaaaggc
cttcacaacctacgaaactacagttcagatttgggaaagcagccgaaaaaggtgcctaaa
cgtcgccaggccgcccgagagctgtccattcagcgccgttctgccctcaatgtgaggctc
ttcctcagagacttctgctctgagttcctggagaactgttacaaccggctcatgggatca
gtaaaggatcacctgcttcgggagaaagctcagcagcatgatgagacctattatatgtgg
gccttggctttcttcatggccttcaaccgagctgcctccttccggccaggcctggtttct
gagaccctcagtgtccgtaccttccacttcattgagcagaacctcaccaactactatgag
atgatgctgactgaccgcaaggaagctgcctcctgggcacgccggatgcacttggctctg
aaggcctatcaggagctgctggcaacagtgaatgagatggacatatctccagatgaggct
gtgagggagagcagccgcatcatcaagaacaatattttctatgtgatggagtaccgagaa
ctattcctggcactttttcgaaagtttgatgagagatgccagccccgctctttccttcgt
gacctggtggagaccacccacctcttcctcaaaatgttggagcgattctgtcggagccgt
gggaacctggtggtgcagaacaaacaaaagaagagaaggaagaagaagaagaaggtccta
gaccaggccattgtttctggtaatgtcccatctagcccagaagaagtggaggctgtgtgg
ccagccctggctgagcagctacagtgctgtgcccagaattctgagctcagcatggactcc
gtggttccctttgatgcggcctcagaggtgccagtggaggagcagcgggcagaagctatg
gtacggatccaagactgtctcctggctggccaggccccacaggccctgactctcctgagg
tctgctcgggaggtgtggcctgaaggagatgtgtttggctctcaagacatttctccagag
gaagagatccagttgctgaaacaaatcctctctgctccacttccccggcagcagggccca
gaggaacgtggggcagaggaagaagaagaggaggaggaggaggaagaggaggagttgcaa
gtggtccaggtgtcggagaaagaatttaattttctggactacctgaaacgctttgcatgt
tcaactgtcgttcgagcctatgtgctgctactaaggagctaccagcagaatagtgcccac
actaaccattgcattgtgaagatgctgcaccggctggcccatgacctcaaaatggaagcc
ctactttttcagctgtcagtcttctgcctcttcaatcgtctgcttagtgaccctgctgct
ggagcctacaaagagctagtgacttttgccaaatacatcctgggcaaattttttgcactg
gctgcagtcaaccaaaaagcctttgtggagctgttgttctggaagaacacagctgtggtt
cgagagatgactgagggctatggctccctggatgacaggtcttccagtcgcagagcacct
acatggagccccgaagaagaggctcatcttcgggagctgtacctcgccaataaggacgtg
gaagggcaggatgtggtggaagccatcttggcccacctgaatactgttcctcgaacacgc
aagcagatcatccaccatctggtacagatgggactggctgacagtgtcaaggacttccaa
aggaaaggaacccatattgtactgtggacgggggatcaggagttggagctgcagcggctt
tttgaggaattccgggactcagatgatgtcctgggtcatatcatgaagaatatcacagcc
aaacgctcacgggcccgaatagtggataaactcttggctctggggctggtggctgagcgg
cgggagctgtacaagaaacggcagaaaaagttggcatcctccatcttgccaaatggagcg
gagtccctgaaagatttttgccaggaagatctggaagaagaggaaaacctgcctgaggaa
gacagcgaagaggaagaagaagggggctcagaagcagaacaagtccagggtagcttagtc
ctttcaaatgaaaaccttggtcaaagcctgcatcaggaaggcttttctatcccgctccta
tggctccagaactgcctgatccgagcagctgatgatcgggaagaggatggctgctcccag
gccgttccattggtgccactcacagaggaaaatgaggaagccatggaaaacgaacagttt
cagcagctgttgcgcaagctaggggttcggccccctgcctctgggcaggaaaccttctgg
cgaattccagccaagctgagtcctacccagctccggagggcagcagcttctttgagtcaa
ccagaggaggaacagaagctgcagccagagctgcagcctaaagtccctggagagcaaggc
tctgatgaggagcactgtaaagagcaccgagcacaagccctgagggccctcttgctagcc
cacaagaagaaagcgggcctggcatccccagaggaggaagacgctgttggtaaagagccg
ctgaaggcagcacccaagaaacgacaattgctggacagcgacgaggaacaggaagaagat
gagggcaggaacagagcaccagagttgggagctccaggaatccaaaagaagaaacgatac
cagattgaggatgatgaggatgactga

DBGET integrated database retrieval system