KEGG   Homo sapiens (human): 8915Help
Entry
8915              CDS       T01001                                 

Gene name
BCL10, CARMEN, CIPER, CLAP, IMD37, c-E10, mE10
Definition
(RefSeq) B cell CLL/lymphoma 10
  KO
K07368  B-cell CLL/lymphoma 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8915 (BCL10)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    8915 (BCL10)
   04660 T cell receptor signaling pathway
    8915 (BCL10)
   04662 B cell receptor signaling pathway
    8915 (BCL10)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    8915 (BCL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD Flu_B_NS1
Motif
Other DBs
NCBI-GeneID: 8915
NCBI-ProteinID: NP_003912
OMIM: 603517
HGNC: 989
Ensembl: ENSG00000142867
Vega: OTTHUMG00000009965
Pharos: O95999(Tbio)
UniProt: O95999
Structure
PDB: 

Position
1p22.3
AA seq 233 aa AA seqDB search
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
SCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVG
RTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaccgcaccgtccctcaccgaggaggacctcactgaagtgaagaaggacgcc
ttagaaaatttacgtgtatacctgtgtgagaaaatcatagctgagagacattttgatcat
ctacgtgcaaaaaaaatactcagtagagaagacactgaagaaatttcttgtcgaacatca
agtagaaaaagggctggaaaattgttagactacttacaggaaaacccaaaaggtctggac
acccttgttgaatctattcggcgagaaaaaacacagaacttcctgatacagaagattaca
gatgaagtgctgaaacttagaaatataaaactagaacatctgaaaggactaaaatgtagc
agttgtgaaccttttccagatggagccacgaacaacctctccagatcaaattcagatgag
agtaatttctctgaaaaactgagggcatccactgtcatgtaccatccagaaggagaatcc
agcacgacgccctttttttctactaattcttctctgaatttgcctgttctagaagtaggc
agaactgaaaataccatcttctcttcaactacacttcccagacctggggacccaggggct
cctcctttgccaccagatctacagttagaagaagaaggaacttgtgcaaactctagtgag
atgtttcttcccttaagatcacgtactgtttcacgacaatga

DBGET integrated database retrieval system