KEGG   Homo sapiens (human): 8925
Entry
8925              CDS       T01001                                 

Gene name
HERC1, MDFPMR, p532, p619
Definition
(RefSeq) HECT and RLD domain containing E3 ubiquitin protein ligase family member 1
  KO
K10594  E3 ubiquitin-protein ligase HERC1 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Disease
H02298  Macrocephaly, dysmorphic facies, and psychomotor retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8925 (HERC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8925 (HERC1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     8925 (HERC1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   8925 (HERC1)
SSDB
Motif
Pfam: RCC1 RCC1_2 HECT SPRY WD40
Other DBs
NCBI-GeneID: 8925
NCBI-ProteinID: NP_003913
OMIM: 605109
HGNC: 4867
Ensembl: ENSG00000103657
Vega: OTTHUMG00000172433
Pharos: Q15751(Tdark)
UniProt: Q15751 A0A024R5W0
Structure
PDB: 
4QT6 4O2W

Position
15q22.31
AA seq 4861 aa
MATMIPPVKLKWLEHLNSSWITEDSESIATREGVAVLYSKLVSNKEVVPLPQQVLCLKGP
QLPDFERESLSSDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNK
YHDKGKVKQQQHSPESSSGSADVHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
VSGPGLSLCNDVIHTAIEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGAD
TLGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVHTMEKGKLLSSQEGMISFDCFM
TILMQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSI
QTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQTIEAGQYCTFVIST
DGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVF
SWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDF
GRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDTN
RVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIE
ELAATRIVDVSIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGIAI
QQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLP
FPSSREHHSFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSTVPDEIQE
VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHVA
SLLGYSSPSDAADLSSVCTGYGNLSDQPYGTQSCHPDTHLAEILMKTLLRNLGFYTDQAF
GELEKNSDKFLLGTSSSENSQPAHLHELLCSLQKQLLAFCHINNISENSSSVALLHKHLQ
LLLPHATDIYSRSANLLKESPWNGSVGEKLRDVIYVSAAGSMLCQIVNSLLLLPVSVARP
LLSYLLDLLPPLDCLNRLLPAADLLEDQELQWPLHGGPELIDPAGLPLPQPAQSWVWLVD
LERTIALLIGRCLGGMLQGSPVSPEEQDTAYWMKTPLFSDGVEMDTPQLDKCMSCLLEVA
LSGNEEQKPFDYKLRPEIAVYVDLALGCSKEPARSLWISMQDYAVSKDWDSATLSNESLL
DTVSRFVLAALLKHTNLLSQACGESRYQPGKHLSEVYRCVYKVRSRLLACKNLELIQTRS
SSRDRWISENQDSADVDPQEHSFTRTIDEEAEMEEQAERDREEGHPEPEDEEEEREHEVM
TAGKIFQCFLSAREVARSRDRDRMNSGAGSGARADDPPPQSQQERRVSTDLPEGQDVYTA
ACNSVIHRCALLILGVSPVIDELQKRREEGQLQQPSTSASEGGGLMTRSESLTAESRLVH
TSPNYRLIKSRSESDLSQPESDEEGYALSGRRNVDLDLAASHRKRGPMHSQLESLSDSWA
RLKHSRDWLCNSSYSFESDFDLTKSLGVHTLIENVVSFVSGDVGNAPGFKEPEESMSTSP
QASIIAMEQQQLRAELRLEALHQILVLLSGMEEKGSISLAGSRLSSGFQSSTLLTSVRLQ
FLAGCFGLGTVGHTGGKGESGRLHHYQDGIRAAKRNIQIEIQVAVHKIYQQLSATLERAL
QANKHHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQLLP
KTGVSQLSTALKVASTRLLQILAITTGTYADKLSPKVVQSLLDLLCSQLKNLLSQTGVLH
MASFGEGEQEDGEEEEKKVDSSGETEKKDFRAALRKQHAAELHLGDFLVFLRRVVSSKAI
QSKMASPKWTEVLLNIASQKCSSGIPLVGNLRTRLLALHVLEAVLPACESGVEDDQMAQI
VERLFSLLSDCMWETPIAQAKHAIQIKEKEQEIKLQKQGELEEEDENLPIQEVSFDPEKA
QCCLVENGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDF
NHRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLA
FEDVDAAELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPICSPVAAVLAEATIQLI
RILHRTDRWTYCINKKMMERLHKIKICIKESGQKLKKSRSVQSREENEMREEKESKEEEK
GKHTRHGLADLSELQLRTLCIEVWPVLAVIGGVDAGLRVGGRCVHKQTGRHATLLGVVKE
GSTSAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLPFDVARFRGLTASVLLDLTYLT
GVHEDMGKQSTKRHEKKHRHESEEKGDVEQKPESESALDMRTGLTSDDVKSQSTTSSKSE
NEIASFSLDPTLPSVESQHQITEGKRKNHEHMSKNHDVAQSEIRAVQLSYLYLGAMKSLS
ALLGCSKYAELLLIPKVLAENGHNSDCASSPVVHEDVEMRAALQFLMRHMVKRAVMRSPI
KRALGLADLERAQAMIYKLVVHGLLEDQFGGKIKQEIDQQAEESDPAQQAQTPVTTSPSA
SSTTSFMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTVLPTRRAQ
TPPISSLPTSPSDEVGRRQSLTSPDSQSARPANRTALSDPSSRLSTSPPPPAIAVPLLEM
GFSLRQIAKAMEATGARGEADAQNITVLAMWMIEHPGHEDEEEPQSGSTADSRPGAAVLG
SGGKSNDPCYLQSPGDIPSADAAEMEEGFSESPDNLDHTENAASGSGPSARGRSAVTRRH
KFDLAARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEAME
AMFGQDLTSDNDILGMWIPEVLDWPTWHVCESEDREEVVVCELCECSVVSFNQHMKRNHP
GCGRSANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGTCREKYLAMKTKSKSTSSERYKG
QAPDLIGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSDP
LGASVAMVTATNSMEETLMQIGCHGSVEKSSSGRITLGEQAAALANPHDRVVALRRVTAA
AQVLLARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCLAAAGRAGLSTSPS
AMASTSERSRGGHSKANKPISCLAYLSTAVGCLASNAPSAAKLLVQLCTQNLISAATGVN
LTTVDDSIQRKFLPSFLRGIAEENKLVTSPNFVVTQALVALLADKGAKLRPNYDKSEVEK
KGPLELANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTTLQTLADMGGDLRKCS
FIKLEAHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQTCVFNRLEGDAEES
LGSPSDPSFSPVSWSISGKYLAGALEKMVNIWQVNGGKGLVDIQPHWVSALAWPEEGPAT
AWSGESPELLLVGRMDGSLGLIEVVDVSTMHRRELEHCYRKDVSVTCIAWFSEDRPFAVG
YFDGKLLLGTKEPLEKGGIVLIDAHKDTLISMKWDPTGHILMTCAKEDSVKLWGSISGCW
CCLHSLCHPSIVNGIAWCRLPGKGSKLQLLMATGCQSGLVCVWRIPQDTTQTNVTSAEGW
WEQESNCQDGYRKSSGAKCVYQLRGHITPVRTVAFSSDGLALVSGGLGGLMNIWSLRDGS
VLQTVVIGSGAIQTTVWIPEVGVAACSNRSKDVLVVNCTAEWAAANHVLATCRTALKQQG
VLGLNMAPCMRAFLERLPMMLQEQYAYEKPHVVCGDQLVHSPYMQCLASLAVGLHLDQLL
CNPPVPPHHQNCLPDPASWNPNEWAWLECFSTTIKAAEALTNGAQFPESFTVPDLEPVPE
DELVFLMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVP
AAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFV
VTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMS
CGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLA
VSADGSMVWAFGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHV
YTFGQDRLIGLPEGRARNHNRPQQIPVLAGVIIEDVAVGAEHTLALASNGDVYAWGSNSE
GQLGLGHTNHVREPTLVTGLQGKNVRQISAGRCHSAAWTAPPVPPRAPGVSVPLQLGLPD
TVPPQYGALREVSIHTVRARLRLLYHFSDLMYSSWRLLNLSPNNQNSTSHYNAGTWGIVQ
GQLRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIARQVVKL
NASDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGIVDLLIPSPNATAEVGYN
RDRFLFNPSACLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPLVWKQLCCVPLTLEDLEE
VDLLYVQTLNSILHIEDSGITEESFHEMIPLDSFVGQSADGKMVPIIPGGNSIPLTFSNR
KEYVERAIEYRLHEMDRQVAAVREGMSWIVPVPLLSLLTAKQLEQMVCGMPEISVEVLKK
VVRYREVDEQHQLVQWFWHTLEEFSNEERVLFMRFVSGRSRLPANTADISQRFQIMKVDR
PYDSLPTSQTCFFQLRLPPYSSQLVMAERLRYAINNCRSIDMDNYMLSRNVDNAEGSDTD
Y
NT seq 14586 nt   +upstreamnt  +downstreamnt
atggcaactatgattccaccagtgaagctgaaatggcttgaacacttgaacagctcctgg
attacagaggacagtgaatctattgctacaagagagggagttgctgttctgtattctaaa
ctggttagcaataaggaagtagtacctttgccccaacaagttttatgcctcaaaggacca
cagttgccagactttgaacgtgagtctctttcaagtgatgagcaggaccactatttggat
gcccttcttagcagccagctagcattggcaaagatggtatgttcagattccccatttgcc
ggggcacttagaaaacgactgcttgtactccagcgtgtcttttatgcactttctaataaa
taccatgacaaaggcaaggtgaagcagcagcagcattctccggagagcagttctggttca
gcagatgtccattctgttagtgaacgcccccggtcaagcactgatgcacttatagaaatg
ggtgttcgaactggtctaagtttattatttgcgcttctaagacaaagttggatgatgcct
gtgtcaggacctggtctcagtctttgcaacgatgtcattcatactgcaattgaagttgtg
agctctttgccaccattatcattagcaaatgaaagcaagattcctcctatgggcttggac
tgcttatcgcaagtaacaacatttcttaaaggagtcactattcctaattctggggcagac
actttaggtcgtagattagcttctgagttgctgcttggtttggcagctcaacgaggctca
ttgcgatatcttcttgaatggatagaaatggctttgggggcttcggcagttgtacacacc
atggagaaaggcaaactactctcaagccaggaaggaatgatcagctttgactgctttatg
accatattaatgcagatgaggcgttctttgggttcatctgctgatcggagtcagtggaga
gaaccaaccagaacatcggatggcttgtgctccctttacgaggcagcattatgtctcttt
gaagaggtttgcagaatggcttctgattattcgagaacatgtgctagcccagatagcatt
cagactggtgatgctcccattgtctccgaaacctgtgaggtttatgtttgggggagcaat
agcagccatcagttggtagaaggtacacaggagaaaatactgcaacccaaactggctcct
agtttctctgatgcacagaccattgaagctggacagtactgcacttttgtcatttctacg
gatggctctgttagagcttgcgggaaaggcagctatgggagactgggccttggagactcc
aataatcagtcaactttaaaaaagttaacattcgagcctcacagatccattaaaaaggtt
tcatcttctaaaggatctgatggtcacactttagcctttacgacagaaggagaagtcttc
agttggggagatggtgattatgggaaactggggcatggaaatagttcaacacagaaatat
cccaagcttattcagggacctctacaaggaaaggtagttgtttgtgtgtcagctggatac
agacatagtgctgctgtcacagaggatggggaattatacacatggggtgaaggagacttt
ggaagattaggtcatggtgacagcaatagtcgtaacattccaacattagtaaaagacatc
agcaatgtaggagaggtttcttgtggcagttcacatactattgctctgtctaaagatggg
agaactgtatggtcttttggaggaggagacaatggtaaacttggtcatggtgataccaac
agagtgtataaacctaaagttattgaagctttacaaggaatgttcattcgcaaagtttgt
gctgggagccagtcttcacttgctttgacatcaacagggcaggtctatgcttggggctgt
ggagcttgtctaggttgtggttcttcagaagctactgctttgagacccaagcttattgaa
gaactggctgccacaagaatagttgatgtttctattggagacagtcattgtttggctctt
tctcatgataatgaagtttatgcctggggcaataactcaatggggcaatgtggtcaggga
aattccacaggtcctattactaaaccaaagaaagtgagtggcttagatggcatagctatt
cagcagatttcggctggaacatcacatagtctggcatggactgctcttcctagggacaga
caagttgttgcatggcaccgaccttattgtgtagatcttgaagagagtaccttctcacac
ctgcgttcttttcttgagagatactgtgataaaataaacagtgagattcccccactccct
ttcccttcatcaagagaacaccacagttttctcaagctgtgcctgaagctactttcaaat
caccttgctcttgcacttgcgggaggggtagctaccagcattctcgggaggcaggcaggt
ccacttcgaaatttgctcttcagactgatggactcaactgtcccagatgaaatccaagag
gtggtaattgaaactttatcagtgggagcaaccatgctgttacctccattacgagaacgg
atggaattacttcattctcttttacctcaaggacctgatagatgggaaagcttatctaaa
ggacagagaatgcaactggatatcatcctgacaagtttgcaagatcatacccacgtagcc
tccctacttggctatagttcaccctctgatgctgctgacctatcttctgtgtgtactggc
tacggaaatctgtcagatcaaccttacggcactcagagctgccatccagatacccacctg
gctgaaattttgatgaagaccctcttaagaaatttaggattttatacagatcaagcattt
ggagagctagaaaagaatagtgataaatttctacttggaacatcatcatcagaaaacagt
cagcctgctcatcttcatgaactgctatgttcactacagaaacagctgctggcattttgc
catatcaataacattagtgagaactcaagcagtgtggcattgcttcataaacatcttcag
cttttgttgcctcatgccacagatatttattcacgttctgcaaatttgctcaaagaaagt
ccttggaatggcagtgttggagaaaaattaagagatgtgatatacgtctcagctgctggc
agtatgctctgccagattgttaactccctgctgttactccctgtgtcagtggctcggcct
ttattgagttacctcctcgacttgttgccacctcttgattgccttaatagactcctgcca
gctgctgatcttttagaagaccaggagttacagtggcctcttcatggagggccagaacta
attgatcctgctggtctgccattacctcagccagctcagtcctgggtatggcttgtggat
ctagaaagaacaattgctctccttattgggcggtgtcttggtggcatgcttcagggctcc
cctgtgtctccagaggaacaggacactgcatattggatgaaaacgccactgttcagtgac
ggtgtagaaatggacactcctcaattggataaatgtatgagttgcctgttagaagtagca
ctttctggaaatgaagaacagaagccttttgattataaattgcggcctgaaattgctgtc
tatgtagacttggcattgggttgttctaaagagcctgcccgaagcctttggatcagcatg
caggactatgctgttagtaaagattgggacagtgcaactttaagtaatgagtcactcttg
gacactgtgtctagatttgttcttgcagctcttctgaaacacacaaatttacttagtcaa
gcatgtggagaaagccgatatcaacctggtaaacacttatcagaagtgtaccgttgtgta
tacaaagttcgaagtcgtttacttgcttgcaagaaccttgaacttattcaaacaaggtca
tcatcacgggacagatggatatcagaaaaccaggactctgcagatgttgatcctcaggag
cattcatttactcgaactattgatgaagaagctgaaatggaagaacaggctgagagagac
cgggaagaggggcatccggagccagaggatgaagaggaggaacgggaacatgaagtgatg
acagctggcaaaatctttcagtgtttcctctcagcccgtgaagtagctcgtagccgagac
cgagatagaatgaacagtggggcagggtctggggctcgagctgatgatccacctcctcag
tctcagcaagagcgaagggtcagcacagaccttcctgagggtcaggatgtgtacactgct
gcatgcaactccgtgatccatcggtgtgccctgttaatattaggagtaagtcctgtgata
gatgagcttcagaagcgaagagaagaaggacagttgcagcaaccttcaacaagtgcctct
gaagggggtggacttatgaccaggagtgaaagtcttactgcagagagccggctagtccac
acaagcccaaattatagactgatcaaatcgaggagtgaatctgatttgtctcagcctgaa
tcagatgaagagggttacgcactgagtggcagacgaaatgttgatttggatttggcagca
tctcacagaaagagaggtcctatgcacagtcaattggaatccctgagtgactcttgggct
cgcctgaaacatagcagagactggttatgcaactcctcctattcctttgagtcagatttt
gatcttaccaagtctttgggagttcacactttgattgaaaatgttgtaagctttgtgagt
ggagatgtggggaatgccccaggttttaaagagccagaggaaagtatgtctacaagtccc
caggcctccatcattgcaatggaacagcagcagttaagggcagaacttcgtttagaggca
cttcatcagatcctcgttctattgtctgggatggaagaaaaaggtagcatctcactggca
ggaagcagattgagttcaggcttccagtcctccacactactcacgtctgtgaggctgcag
ttcctagcagggtgttttggtttaggcactgttggacacacaggaggcaagggagagagt
ggccgattgcatcactatcaggatgggatcagagcagctaagagaaatattcagattgaa
atccaggtagctgtgcataaaatttatcaacagttgtctgctaccctggaaagagccctg
caagcaaacaagcatcacattgaagcccagcaacgtctgcttctggttacagtttttgcc
ctaagtgttcattatcaaccagtagatgtttctttggcaatttccactggtctgctaaac
gtattgtcacagttgtgtggtacagacaccatgctaggacagcccctgcagttgttgcca
aagacgggtgtttcccagcttagcacagctttgaaagtggccagtacaaggttgctccag
attctagccatcactactgggacctatgctgataaactgagtcccaaagtagttcaatcc
ttgttggatctactctgtagtcagttgaagaatttattgtcccaaactggtgtactacat
atggcctctttcggagaaggggagcaagaagacggtgaagaagaagaaaaaaaagttgac
tccagtggagaaactgagaagaaagatttcagagctgctcttaggaaacaacatgcagcc
gaactccatctaggggattttttagtttttcttcgcagagttgtatcttcaaaagcaatt
caatcaaaaatggcttccccaaagtggaccgaagtgcttctaaatatagcatctcagaaa
tgttcttcaggtatccctctggttggtaacttaagaacaaggctccttgcacttcatgtc
cttgaagctgtgctgccagcttgtgaatctggtgtagaagatgatcaaatggcccagatt
gttgagcgcttattttcccttctctctgattgtatgtgggagacacccattgctcaggcc
aaacatgctattcagataaaggaaaaagaacaagaaataaaactacagaagcagggcgag
ttggaagaagaagatgagaatcttcctatccaagaagtatcctttgacccggagaaagct
cagtgttgcctagtggagaatggacagattttaactcacggcagtggagggaaaggatat
ggattggcatctacaggagtaacttctgggtgctatcagtggaagttttatattgtgaag
gaaaacagaggtaatgaaggcacgtgtgttggagtttctcgctggccagtacatgacttt
aatcaccgcactacctcggatatgtggctctatagggcctacagtggtaacctctatcac
aatggagaacagactctcacattgtccagctttactcaaggagatttcattacctgtgtg
ttagacatggaagccaggaccatttcttttgggaaaaatggagaggaacccaaattagct
tttgaagatgtggatgcagcagagttgtacccatgtgtgatgttctatagtagcaatcca
ggggaaaaggtgaaaatttgtgatatgcagatgcgtggcacaccccgagacttacttcca
ggagaccctatttgtagtccagtagcagcagtgctggctgaggccactattcagctcatc
cgtatccttcaccgaacagaccgttggacttactgcattaacaaaaaaatgatggaaagg
cttcacaaaattaagatatgtattaaagagtcaggtcagaagctaaagaaaagccgctcg
gttcagagccgagaggaaaatgaaatgagagaggagaaggagagcaaagaggaagagaaa
ggtaaacatactaggcatggcctcgctgacctctcagagctgcagctgaggactctttgc
atagaggtgtggcccgtgctggctgtgataggaggagttgatgctggtcttagagttgga
ggtcggtgtgttcacaagcaaactgggcgccatgccacgctgctgggagtggtcaaagag
ggcagcacgtctgccaaggtccaatgggatgaagcagaaattactatcagcttcccaact
ttttggtcgcctagtgatactccattgtataatctggaaccctgtgaaccattgccgttt
gatgtggcgcgattccgaggcctgacggcttctgtgctgctggacctaacatatctcact
ggcgttcatgaagacatgggcaaacagagcaccaaacgacatgaaaagaaacaccgacat
gaatccgaggagaaaggggatgttgagcagaaacctgagagtgaatccgctttagatatg
cgaacaggcctaacatctgatgacgtcaaaagtcagagtaccacaagctccaaatcagaa
aatgaaatcgcttcattttctttagatccaacactgccaagtgtggaatcccaacatcaa
ataacagaagggaaaagaaaaaatcatgaacacatgtccaaaaaccatgatgtagcccag
tcagaaatcagagcagtccagctgtcctatctttacctcggtgctatgaagtcacttagt
gcccttcttggctgtagtaaatatgctgagctgttgctgataccaaaagttctggctgaa
aatggccacaactcagactgtgcaagttctccagttgttcatgaagacgtggagatgcga
gcagccctgcagttcttgatgcgacacatggtgaagcgagcagtcatgcggtcacccata
aagagagcattgggattagctgatctggaacgagcgcaagccatgatctataaattagtg
gttcatgggcttttggaagaccagtttgggggcaaaattaagcaagagattgatcaacaa
gctgaagaaagtgaccctgcccagcaggcacagacaccagttactactagcccatcagcc
tcaagcacgacctcctttatgagcagctctctggaggacaccacaactgccaccactcca
gtcactgacacagaaacagtgcctgcatccgagtccccgggagtgatgcctcttagtctt
ctcaggcaaatgttctctagttacccaactaccactgtacttcccacacgtcgggcacag
actcctccaatatcttcgttaccaacctctccttctgatgaagtaggaaggaggcaaagt
ttaacttctcctgattcccagtcagcaaggccagctaaccgcacagccttgtcagaccca
agcagtagactttcaacttctcctcctcctccagcaattgcagttcccttgctggaaatg
gggttctctcttcggcagattgccaaagccatggaagctacaggtgctaggggagaggct
gatgcccagaatatcactgtccttgccatgtggatgatagagcaccctgggcatgaggat
gaagaggagccccagtcgggcagcacagcagactctaggcctggagcagccgttctaggc
agtggcgggaagtcaaatgatccctgttatttgcagtcacctggagacataccatcagct
gatgctgctgaaatggaggaaggttttagtgaaagccctgataatttggatcatacagag
aatgcagcttctggaagtggaccatcagctagaggtcgctcagcggtaacaagaagacac
aagtttgacttagctgctcgcacactgctagcaagagcagcgggattataccgctctgtg
caggcccacaggaatcaaagtcggagagaaggaatatctttgcagcaagacccaggggcg
ttgtatgactttaatttagatgaggaattggaaattgatcttgatgatgaggcgatggaa
gctatgtttggacaagacctgaccagtgacaatgatattctgggaatgtggatcccagag
gtactggattggcctacctggcatgtttgtgagtctgaagacagggaagaagtggtggtg
tgtgaactgtgtgaatgcagcgtcgtcagcttcaatcagcacatgaagagaaaccatcca
ggctgtgggcgcagtgcaaaccgccagggctatcgcagcaatggttcctatgtggatggc
tggtttggcggtgaatgtgggagtggaaatccgtactacctgttatgtggcacctgcagg
gagaagtacttagccatgaagaccaaatctaagtcaacaagttctgaaaggtacaaggga
caagctccagatctaattggcaagcaagacagtgtgtatgaagaagactgggacatgttg
gatgttgatgaagatgaaaagctaactggtgaagaagaatttgaattacttgctggaccg
cttggtttaaatgaccggcgcattgtaccagaaccagttcagttccctgacagcgatcca
ctgggagcatcagtagcaatggtcacagccaccaacagtatggaagagactctgatgcaa
ataggttgccatggctccgtagaaaagagctcctctgggagaataacgttaggagagcag
gcagctgccctagcaaaccctcatgaccgtgtggtggctttaaggagagtgactgctgct
gctcaggttcttctggccagaaccatggtcatgagagcgctgtctcttctctcagtcagt
ggttccagttgtagcctggctgctggtcttgagtctctggggctaacagatatccgaacg
ctagttcgattaatgtgcttggcagcagcagggagagctggcctctccaccagcccttct
gccatggctagcacctcagaacgatcacgaggtgggcatagcaaggctaacaagcctatc
tcttgcctggcctatttgagcacagcagtgggatgtctggcatcaaatgctcctagtgct
gccaaactgcttgtacagttgtgtacacagaacttgatttctgctgcaacaggtgtaaat
ctaaccacagttgatgactcaattcagcgaaagtttctacccagctttctccgaggaatt
gctgaagagaacaagcttgtgacctccccaaactttgttgtaacacaggcccttgtggca
ttgctagcagacaaaggggccaaactaagacctaactatgataagtcagaagttgaaaag
aaaggccctctggagttggctaatgccctggcagcctgctgcctctcctccaggctgtcc
tcacagcatcggcaatgggcagctcagcaactcgtgcgcactcttgctgcacacgaccgt
gacaaccaaactactctgcagacacttgctgatatgggaggagatcttagaaaatgctcc
tttatcaaattggaggctcatcagaacagagtaatgacatgtgtttggtgtaataaaaaa
ggtcttttggctacaagtggcaatgatggcaccatccgcgtatggaatgttaccaagaag
caatattcactgcaacagacctgtgtgttcaacagattggaaggggatgctgaggaaagc
ctgggatcacccagtgatccaagtttctcaccagtttcctggagtatcagtggcaaatat
ctagcaggcgctttggaaaagatggtgaatatctggcaagttaatggaggaaaaggatta
gtagatattcagcctcattgggtatctgccctggcttggccagaagagggtccggctaca
gcctggtcaggagagtctccagaattgttgttggtgggacggatggatggatctctggga
ctgattgaagttgttgatgtgtccaccatgcaccgtcgagaattggagcattgctatcga
aaggatgtgtctgttacttgcattgcatggttcagtgaagacagaccatttgcagtggga
tattttgatggaaaactgttactgggaacaaaggaaccacttgagaaaggaggcattgtt
ctaattgatgcacataaggatactcttattagcatgaagtgggaccctacaggtcatatt
cttatgacatgtgccaaagaagacagtgtgaaactctggggctctatttcgggatgctgg
tgctgtctacattcactctgccatccatctattgtaaatggcattgcttggtgccgcctt
ccagggaaaggatccaagttgcagttactgatggctactggctgtcagagtggcttagta
tgtgtttggcgcattcctcaagatactacacagaccaatgtgactagtgcagaaggatgg
tgggagcaggaatcaaattgccaggatggatataggaaatcatcaggagccaagtgtgtt
tatcagctgcggggacacatcactcctgttcggactgttgcctttagttctgatgggttg
gccctggtgtctggtggactaggtgggctcatgaacatttggtctttaagggatggctct
gtcttgcaaactgttgtgataggctctggagctattcagaccacagtatggattccagaa
gttggagtagctgcttgctcaaatagatcaaaggatgttttggtcgtgaattgtacagca
gaatgggcagctgccaatcatgttttggcaacctgtaggacagcattgaaacagcagggt
gttctgggattgaacatggctccctgcatgagagcatttttggagcggctccccatgatg
cttcaggagcagtatgcctatgaaaagcctcatgtggtttgtggtgaccaacttgttcat
agcccctatatgcaatgcttggcttcccttgctgtgggacttcatctggatcagctgttg
tgtaaccctccagtgccaccacaccaccagaactgtctccctgaccctgcatcctggaat
ccaaatgaatgggcctggttagaatgtttctcaaccactataaaagctgccgaagccctg
accaatggagcccagtttccagaatcttttaccgttccagatctagaacctgttccagag
gatgaacttgtatttctaatggataacagtaaatggattaacggcatggatgaacaaatt
atgtcttgggcaacttccagacctgaggactggcacctgggaggtaaatgtgatgtctac
ttatggggtgctggtaggcatggacagctggcagaagctggaagaaatgtaatggtacct
gcagcagctccctcattctcacaggcccaacaggtcatttgtggtcagaattgtaccttt
gtcatccaggccaatggcacagtgttggcttgtggggaaggaagttatggcagattagga
caaggaaattcagatgaccttcatgtgctgacagttatttcagccttacaaggctttgtg
gtgacccagctggtgacttcctgtggttctgatgggcactctatggccctaactgaaagt
ggtgaggtctttagctggggagatggtgactatggtaaacttggccatgggaacagcgac
aggcagcggcggcccaggcagatcgaggccttacaaggagaagaagtggtgcagatgtct
tgtggcttcaagcactcagcagtggtcacttcagatggcaaactgttcacctttgggaat
ggtgactatggtcgtctgggtcttggaaatacctctaacaaaaaacttccagagagagtg
actgcactggagggatatcagattggacaggtggcctgtggattaaaccacactttggca
gtgtcagcagatggttccatggtgtgggcttttggagatggagactatggaaaactaggc
ttaggaaattccactgcaaaatcttcacctcagaaaattgacgtcctttgtggaattgga
ataaaaaaggttgcttgtggaactcagttttctgttgctttgaccaaagatggtcatgtg
tatacctttggtcaagatcgcctgataggcttgccagaggggcgtgctcgcaatcacaat
cgaccgcaacaaatccctgtcctggctggagtaatcatagaagatgtggcagttggagct
gaacacacacttgctttggcatcaaatggagatgtgtatgcctgggggagcaattcagaa
gggcagctcggcttaggccataccaaccatgttcgagaaccaaccctggtaacaggtctg
caagggaaaaatgttcggcagatctcggctggccgctgccacagtgctgcatggacagca
ccacctgtcccaccaagagcaccaggtgtgtcagtacctctgcagctgggcctgcctgac
acagtgcccccccagtatggggcgctgagagaagtcagcattcacacggtgcgggccagg
ctccggctgctctaccacttctctgacctcatgtactcatcctggagactgctgaacctt
agccccaacaaccagaacagcacatcccattataatgctggaacttggggcattgtacag
ggacaacttcggcctttgttagccccaagagtctacactctgccaatggtgcgctccata
ggaaaaaccatggttcaaggcaaaaactatggacctcagataactgtaaagaggatatca
accagaggacggaagtgtaagcctatttttgtccaaatagcgagacaagtagttaagctg
aatgcttcagacctccgcctgccttcccgagcgtggaaggttaagctggttggagaaggg
gctgatgatgctggaggagtgtttgatgacaccatcacagagatgtgccaggaacttgaa
actggtattgttgaccttcttataccctctcccaatgccaccgcagaagtgggttacaat
agggacaggttcctttttaacccttctgcctgcctcgatgaacacttaatgcagtttaag
tttttaggaattttaatgggggttgccattcgcacaaagaagcctctggacctccacttg
gcccctctggtgtggaagcagctgtgctgtgtcccactcaccctagaggacctggaggag
gtggatctgctctacgtgcagactctcaacagcattcttcacattgaagacagtgggatt
accgaggagagtttccatgagatgattcctcttgattcttttgttggccagagtgctgat
ggcaaaatggttcctataatccctggtggaaatagtatcccactcacattttccaacagg
aaggaatatgtggagagggccattgaatatcgacttcatgagatggacagacaggtggct
gcagtccgagaagggatgtcctggattgttcctgtgccgctgctgtccctcctcacagca
aaacaactggagcagatggtgtgtgggatgcccgagatctctgtggaagtcttgaagaaa
gtggtgcggtaccgtgaggtggatgagcagcatcagctggtgcagtggttctggcacacg
ctggaagagttctccaatgaggagcgggtgcttttcatgaggtttgtgtcaggaagatct
cgactaccagccaacactgctgacatttctcagagatttcaaatcatgaaggttgatagg
ccttacgacagtctgcctacctcacagacctgcttcttccagctgaggctgcccccgtac
tccagccagctggtcatggccgagcgcctgcgctatgccatcaacaactgccgctcaatc
gacatggacaactacatgctctcgagaaacgtggacaacgccgagggctccgacactgac
tactga

DBGET integrated database retrieval system