KEGG   Homo sapiens (human): 8928Help
Entry
8928              CDS       T01001                                 

Gene name
FOXH1, FAST-1, FAST1
Definition
(RefSeq) forkhead box H1
  KO
K09400  forkhead box protein H
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8928 (FOXH1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    8928 (FOXH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 8928
NCBI-ProteinID: NP_003914
OMIM: 603621
HGNC: 3814
Ensembl: ENSG00000160973
Vega: OTTHUMG00000165172
Pharos: O75593(Tbio)
UniProt: O75593
Position
8q24.3
AA seq 365 aa AA seqDB search
MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQII
RQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEAL
RLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGA
PWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGP
STLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSC
PQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLL
SWCSL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggggccctgcagcggctcccgcctggggcccccagaggcagagtcgccctcccagccc
cctaagaggaggaagaagaggtacctgcgacatgacaagcccccctacacctacttggcc
atgatcgccttggtgattcaggccgctccctcccgcagactgaagctggcccagatcatc
cgtcaggtccaggccgtgttccccttcttcagggaagactacgagggctggaaagactcc
attcgccacaacctttcctccaaccgatgcttccgcaaggtgcccaaggaccctgcaaag
ccccaggccaagggcaacttctgggcggtcgacgtgagcctgatcccagctgaggcgctc
cggctgcagaacaccgccctgtgccggcgctggcagaacggaggtgcgcgtggagccttc
gccaaggacctgggcccctacgtgctgcacggccggccataccggccgcccagtcccccg
ccaccacccagtgagggcttcagcatcaagtccctgctaggagggtccggggagggggca
ccctggccggggctagctccacagagcagcccagttcctgcaggcacagggaacagtggg
gaggaggcggtgcccaccccaccccttccctcttctgagaggcctctgtggcccctctgc
ccccttcctggccccacgagagtggagggggagactgtgcaggggggagccatcgggccc
tcaaccctctccccagagcctagggcctggcctctccacttactgcagggcaccgcagtt
cctgggggacggtccagcgggggacacagggcctccctctgggggcagctgcccacctcc
tacttgcctatctacactcccaatgtggtaatgcccttggcaccaccacccacctcctgt
ccccagtgtccgtcaaccagccctgcctactggggggtggcccctgaaacccgagggccc
ccagggctgctctgcgatctagacgccctcttccaaggggtgccacccaacaaaagcatc
tacgacgtttgggtcagccaccctcgggacctggcggcccctggcccaggctggctgctc
tcctggtgcagcctgtga

DBGET integrated database retrieval system