KEGG   Homo sapiens (human): 8932
Entry
8932              CDS       T01001                                 
Symbol
MBD2, DMTase, NY-CO-41
Name
(RefSeq) methyl-CpG binding domain protein 2
  KO
K11590  methyl-CpG-binding domain protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8932 (MBD2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    8932 (MBD2)
SSDB
Motif
Pfam: MBD_C MBDa MBD
Other DBs
NCBI-GeneID: 8932
NCBI-ProteinID: NP_003918
OMIM: 603547
HGNC: 6917
Ensembl: ENSG00000134046
Pharos: Q9UBB5(Tbio)
UniProt: Q9UBB5
Structure
Position
18:complement(54151606..54224669)
AA seq 411 aa
MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRG
RGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGG
APRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYF
SPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLN
TTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQII
KTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCK
AFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgcgcgcgcacccggggggaggccgctgctgcccggagcaggaggagggggagagtgcg
gcgggcggcagcggcgctggcggcgactccgccatagagcaggggggccagggcagcgcg
ctcgccccgtccccggtgagcggcgtgcgcagggaaggcgctcggggcggcggccgtggc
cgggggcggtggaagcaggcgggccggggcggcggcgtctgtggccgtggccggggccgg
ggccgtggccggggacggggacggggccggggccggggccgcggccgtcccccgagtggc
ggcagcggccttggcggcgacggcggcggctgcggcggcggcggcagcggtggcggcggc
gccccccggcgggagccggtccctttcccgtcggggagcgcggggccggggcccagggga
ccccgggccacggagagcgggaagaggatggattgcccggccctcccccccggatggaag
aaggaggaagtgatccgaaaatctgggctaagtgctggcaagagcgatgtctactacttc
agtccaagtggtaagaagttcagaagcaagcctcagttggcaaggtacctgggaaatact
gttgatctcagcagttttgacttcagaactggaaagatgatgcctagtaaattacagaag
aacaaacagagactgcgaaacgatcctctcaatcaaaataagggtaaaccagacttgaat
acaacattgccaattagacaaacagcatcaattttcaaacaaccggtaaccaaagtcaca
aatcatcctagtaataaagtgaaatcagacccacaacgaatgaatgaacagccacgtcag
cttttctgggagaagaggctacaaggacttagtgcatcagatgtaacagaacaaattata
aaaaccatggaactacccaaaggtcttcaaggagttggtccaggtagcaatgatgagacc
cttttatctgctgttgccagtgctttgcacacaagctctgcgccaatcacagggcaagtc
tccgctgctgtggaaaagaaccctgctgtttggcttaacacatctcaacccctctgcaaa
gcttttattgtcacagatgaagacatcaggaaacaggaagagcgagtacagcaagtacgc
aagaaattggaagaagcactgatggcagacatcttgtcgcgagctgctgatacagaagag
atggatattgaaatggacagtggagatgaagcctaa

DBGET integrated database retrieval system