KEGG   Homo sapiens (human): 8940Help
Entry
8940              CDS       T01001                                 

Gene name
TOP3B, TOP3B1
Definition
(RefSeq) DNA topoisomerase III beta
  KO
K03165  DNA topoisomerase III [EC:5.99.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Module
hsa_M00414  Bloom's syndrome complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    8940 (TOP3B)
   03460 Fanconi anemia pathway
    8940 (TOP3B)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Topoisomerases
   8940 (TOP3B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     8940 (TOP3B)
   FA (Fanconi anemia) pathway
     8940 (TOP3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Topoisom_bac Toprim
Motif
Other DBs
NCBI-GeneID: 8940
NCBI-ProteinID: NP_001269041
OMIM: 603582
HGNC: 11993
Ensembl: ENSG00000100038
Vega: OTTHUMG00000167438
Pharos: O95985(Tbio)
UniProt: O95985 A0A024R1C2
Structure
PDB: 

Position
22q11.22
AA seq 862 aa AA seqDB search
MKTVLMVAEKPSLAQSIAKILSRGSLSSHKGLNGACSVHEYTGTFAGQPVRFKMTSVCGH
VMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYIVLWLDCDK
EGENICFEVLDAVLPVMNKAHGGEKTVFRARFSSITDTDICNAMACLGEPDHNEALSVDA
RQELDLRIGCAFTRFQTKYFQGKYGDLDSSLISFGPCQTPTLGFCVERHDKIQSFKPETY
WVLQAKVNTDKDRSLLLDWDRVRVFDREIAQMFLNMTKLEKEAQVEATSRKEKAKQRPLA
LNTVEMLRVASSSLGMGPQHAMQTAERLYTQGYISYPRTETTHYPENFDLKGSLRQQANH
PYWADTVKRLLAEGINRPRKGHDAGDHPPITPMKSATEAELGGDAWRLYEYITRHFIATV
SHDCKYLQSTISFRIGPELFTCSGKTVLSPGFTEVMPWQSVPLEESLPTCQRGDAFPVGE
VKMLEKQTNPPDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYVTVESGRRLKPTNL
GIVLVHGYYKIDAELVLPTIRSAVEKQLNLIAQGKADYRQVLGHTLDVFKRKFHYFVDSI
AGMDELMEVSFSPLAATGKPLSRCGKCHRFMKYIQAKPSRLHCSHCDETYTLPQNGTIKL
YKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSM
LGIGQCVECESGVLVLDPTSGPKWKVACNKCNVVAHCFENAHRVRVSADTCSVCEAALLD
VDFNKAKSPLPGDETQHMGCVFCDPVFQELVELKHAASCHPMHRGGPGRRQGRGRGRARR
PPGKPNPRRPKDKMSALAAYFV
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgtgctcatggttgctgaaaagccgtccttggcacagtcaattgccaaaatc
ctctctagagggagcctgtcctcacacaaagggctgaacggggcctgctcagtccacgag
tacactgggacctttgctggccagccagtgcgcttcaagatgacgtctgtctgtggtcac
gtgatgaccctggatttcctgggaaaatacaacaaatgggacaaagtggaccccgcagaa
ctgttcagccaagctcccacggagaagaaagaagctaaccccaagctgaacatggtgaag
ttcctgcaggtggagggcagaggctgcgactacatcgtgctgtggctggactgcgacaag
gagggggagaacatctgctttgaggttcttgatgctgttctgcccgtcatgaacaaggcc
catggtggcgagaagaccgtgttccgggccaggtttagctccatcacggacacagacatc
tgtaatgccatggcctgcctaggcgagcctgaccacaacgaggcgctctcagtggatgct
cgccaggagctggacctgcgaatcggctgtgcattcaccaggtttcagactaaatatttc
caggggaaatacggtgatttagacagctctctcatctcctttgggccgtgtcagactcca
accctgggattctgtgtggagagacatgataaaatccagtccttcaaaccagagacctac
tgggtgctgcaggccaaggttaacactgacaaagacagatctctccttttggactgggac
cgagtaagagtgtttgaccgggagatcgcacagatgtttttaaacatgacaaagctggag
aaggaagcccaggtggaggccacaagcaggaaagaaaaggccaagcagaggcccctggcc
ctgaacactgtggagatgctgcgtgtggccagctcttctctgggcatggggccgcagcac
gccatgcagacggctgagcggctctacacgcaaggctacatcagctacccacggacagag
accacccactaccctgagaactttgacctgaagggctctctgcggcagcaggccaaccac
ccctactgggccgacacggtgaagcggttgttagcagaaggtatcaaccgcccgcggaaa
ggccatgacgccggcgaccatccccccatcacccccatgaagtctgccacagaggccgaa
ttagggggtgacgcgtggcggctctatgagtacatcaccagacacttcatcgccacggtc
agccatgactgcaagtacctgcagagcaccatctccttcagaattgggcccgagctcttc
acctgctccgggaagaccgtcctctcaccaggcttcacggaggtcatgccctggcagagc
gtgcccctggaggagagcctgcccacttgccagcggggtgatgccttccctgtgggcgag
gtgaagatgctggagaagcagacgaacccacccgactacctgacggaggccgagctcatc
acgctcatggagaagcatggcatcggcacggatgccagcatccctgtgcatatcaacaac
atctgccagcgcaactatgtcacggtggagagcgggcgccggctcaagcccaccaacctc
ggcatcgtcctggtgcacggctactataagattgatgcagagctggtgctccccaccatc
cgcagtgcagtggagaagcagctgaacctgatcgcccagggcaaggccgactaccgccag
gtcctgggccacaccctggacgtgttcaagaggaagttccactactttgtcgactccatt
gctggcatggatgagttgatggaggtgtctttctcgcccctggcggccacaggcaagccc
ctctcacgctgtgggaagtgccaccgcttcatgaagtacatccaggccaagccaagccgc
ctgcactgctcccactgcgatgagacctacacgctcccccagaacggcaccatcaagctc
tacaaggagctccgctgccctctggatgacttcgagctggtcctgtggtcatcaggctct
cggggcaagagctacccgctgtgcccctactgctacaaccacccacccttccgagacatg
aagaaaggcatgggctgcaacgagtgtacgcacccctcctgccagcactcgctgagcatg
ctgggcatcggccagtgcgtggaatgtgagagcggggtgctggtgctggaccccacctcg
ggccccaagtggaaggtggcctgcaacaagtgcaacgtggtagcgcactgcttcgagaac
gcccaccgcgtgcgggtgtccgccgacacctgcagtgtctgtgaggccgccttgcttgat
gtggacttcaacaaggccaagtccccactcccgggcgatgagacgcagcacatgggctgc
gtcttttgtgaccccgtcttccaggagctggtggagctgaagcatgcggcctcctgccac
cccatgcaccgcggtggaccagggagaaggcagggtcgagggcggggccgggccaggagg
ccccctgggaagcccaaccccagacggcccaaggacaagatgtcagccctggccgcctac
tttgtatga

DBGET integrated database retrieval system