KEGG   Homo sapiens (human): 8941Help
Entry
8941              CDS       T01001                                 

Gene name
CDK5R2, NCK5AI, P39, p39nck5ai
Definition
(RefSeq) cyclin dependent kinase 5 regulatory subunit 2
  KO
K19929  cyclin-dependent kinase 5 activator 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8941 (CDK5R2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    8941 (CDK5R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDK5_activator
Motif
Other DBs
NCBI-GeneID: 8941
NCBI-ProteinID: NP_003927
OMIM: 603764
HGNC: 1776
Ensembl: ENSG00000171450
Vega: OTTHUMG00000133083
Pharos: Q13319(Tbio)
UniProt: Q13319
Position
2q35
AA seq 367 aa AA seqDB search
MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVL
ISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKP
LAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQ
ASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY
LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKH
WTMNLDR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggcacagtgctgtctctttcgcctgcctcctcggccaagggccggaggcccggcggg
ctgcccgaggagaagaagaaggcgccgcccgcgggggacgaggcgctggggggctacggg
gcgccgccagtgggcaagggcggcaaaggcgagagccgactcaagcggccgtccgtgctc
atctcggcgctcacctggaagcgcctggtggccgcgtccgccaagaagaagaaaggcagc
aagaaggtgacacccaagccggcatccacgggccccgaccccctggtccagcaacgcaac
cgcgagaaccttctccgcaagggccgggatccccccgacggcggcggcaccgccaagccc
ctggcggtgccagtgcccaccgtgcccgcggctgccgccacctgcgagccaccgtcgggg
ggcagcgcggccgctcagccgccgggctcgggcgggggaaagcctccgccgccgcctccc
ccagccccgcaggtggcgccgccggtgcctggcggctcgccgcggcgggtcatcgtgcag
gcgtccaccggcgagctgctgcgctgtctgggcgacttcgtgtgccgacgctgctatcgc
ctcaaggagctgagcccgggcgagctggtgggctggttccgcggtgtggaccgctcgctg
ctgctgcagggctggcaagaccaggccttcattacgcctgcaaacctggtgttcgtgtac
ctgctgtgccgcgagtcgctgcgtggggacgagctggcgtcggccgccgagctgcaggcc
gccttcctcacctgcctctacctcgcctactcctacatgggcaacgagatctcctaccca
ctcaagcccttcctcgtggagcccgacaaggagcgcttctggcagcgctgcctgcgcctc
atccagcggctcagcccgcagatgctgcggctcaacgccgacccccacttcttcacgcag
gtctttcaagacctcaagaacgagggcgaggccgccgccagcggcgggggcccaccgagc
gggggcgcgcccgccgcctcctcggccgccagggacagctgcgcggccggaaccaagcac
tggactatgaacctggaccgctag

DBGET integrated database retrieval system