KEGG   Homo sapiens (human): 8942
Entry
8942              CDS       T01001                                 

Gene name
KYNU, KYNUU, VCRL2
Definition
(RefSeq) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
hsa_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Disease
H01583  Hydroxykynureninuria
H02087  Vertebral, cardiac, renal, and limb defects syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    8942 (KYNU)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     8942 (KYNU)
SSDB
Motif
Pfam: Aminotran_5 CaKB
Other DBs
NCBI-GeneID: 8942
NCBI-ProteinID: NP_001186170
OMIM: 605197
HGNC: 6469
Ensembl: ENSG00000115919
Vega: OTTHUMG00000131829
Pharos: Q16719(Tchem)
UniProt: Q16719
Structure
PDB: 
3E9K 2HZP

Position
2q22.2
AA seq 465 aa
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLS
LVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLM
KDIVGANEKEIALMNALTVNLHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHG
LNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAG
QAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
ALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALRKK
SVLLTGYLEYLIKHNYGKDKAATKKPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEK
RGVVCDKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAETKN
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggagccttcatctcttgagctgccggctgacacagtgcagcgcattgcggctgaactc
aaatgccacccaacggatgagagggtggctctccacctagatgaggaagataagctgagg
cacttcagggagtgcttttatattcccaaaatacaggatctgcctccagttgatttatca
ttagtgaataaagatgaaaatgccatctatttcttgggaaattctcttggccttcaacca
aaaatggttaaaacatatcttgaagaagaactagataagtgggccaaaatagcagcctat
ggtcatgaagtggggaagcgtccttggattacaggagatgagagtattgtaggccttatg
aaggacattgtaggagccaatgagaaagaaatagccctaatgaatgctttgactgtaaat
ttacatcttctaatgttatcattttttaagcctacgccaaaacgatataaaattcttcta
gaagccaaagccttcccttctgatcattatgctattgagtcacaactacaacttcacgga
cttaacattgaagaaagtatgcggatgataaagccaagagagggggaagaaaccttaaga
atagaggatatccttgaagtaattgagaaggaaggagactcaattgcagtgatcctgttc
agtggggtgcatttttacactggacagcactttaatattcctgccatcacaaaagctgga
caagcgaagggttgttatgttggctttgatctagcacatgcagttggaaatgttgaactc
tacttacatgactggggagttgattttgcctgctggtgttcctacaagtatttaaatgca
ggagcaggaggaattgctggtgccttcattcatgaaaagcatgcccatacgattaaacct
gcattagtgggatggtttggccatgaactcagcaccagatttaagatggataacaaactg
cagttaatccctggggtctgtggattccgaatttcaaatcctcccattttgttggtctgt
tccttgcatgctagtttagagatctttaagcaagcgacaatgaaggcattgcggaaaaaa
tctgttttgctaactggctatctggaatacctgatcaagcataactatggcaaagataaa
gcagcaaccaagaaaccagttgtgaacataattactccgtctcatgtagaggagcggggg
tgccagctaacaataacattttctgttccaaacaaagatgttttccaagaactagaaaaa
agaggagtggtttgtgacaagcggaatccaaatggcattcgagtggctccagttcctctc
tataattctttccatgatgtttataaatttaccaatctgctcacttctatacttgactct
gcagaaacaaaaaattag

DBGET integrated database retrieval system