KEGG   Homo sapiens (human): 8973Help
Entry
8973              CDS       T01001                                 

Gene name
CHRNA6, CHNRA6
Definition
(RefSeq) cholinergic receptor nicotinic alpha 6 subunit
  KO
K04808  nicotinic acetylcholine receptor alpha-6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Cisatracurium: D00759
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rocuronium bromide: D00765
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8973 (CHRNA6)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    8973 (CHRNA6)
 Human Diseases
  Substance dependence
   05033 Nicotine addiction
    8973 (CHRNA6)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   8973 (CHRNA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF1286
Motif
Other DBs
NCBI-GeneID: 8973
NCBI-ProteinID: NP_004189
OMIM: 606888
HGNC: 15963
Ensembl: ENSG00000147434
Vega: OTTHUMG00000165275
Pharos: Q15825(Tchem)
UniProt: Q15825
Position
8p11.21
AA seq 494 aa AA seqDB search
MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVV
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLD
KTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTA
GLFLQPLLGNTGKS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccagcaaggggcagggattccttcatgggggcttgtgtctctggctgtgtgtg
ttcacacctttctttaaaggctgtgtgggctgtgcaactgaggagaggctcttccacaaa
ctgttttctcattacaaccagttcatcaggcctgtggaaaacgtttccgaccctgtcacg
gtacactttgaagtggccatcacccagctggccaacgtggatgaagtaaaccagatcatg
gaaaccaatttgtggctgcgtcacatctggaatgattataaattgcgctgggatccaatg
gaatatgatggcattgagactcttcgcgttcctgcagataagatttggaagcccgacatt
gttctctataacaatgctgttggtgacttccaagtagaaggcaaaacaaaagctcttctt
aaatacaatggcatgataacctggactccaccagctatttttaagagttcctgccctatg
gatatcacctttttcccttttgatcatcaaaactgttccctaaaatttggttcctggacg
tatgacaaagctgaaattgatcttctaatcattggatcaaaagtggatatgaatgatttt
tgggaaaacagtgaatgggaaatcattgatgcctctggctacaaacatgacatcaaatac
aactgttgtgaagagatatacacagatataacctattctttctacattagaagattgccg
atgttttacacgattaatctgatcatcccttgtctctttatttcatttctaaccgtgttg
gtcttttaccttccttcggactgtggtgaaaaagtgacgctttgtatttcagtcctgctt
tctctgactgtgtttttgctggtcatcacagaaaccatcccatccacatctctggtggtc
ccactggtgggtgagtacctgctgttcaccatgatctttgtcacactgtccatcgtggtg
actgtgtttgtgttgaacatacactaccgcaccccaaccacgcacacaatgcccaggtgg
gtgaagacagttttcctgaagctgctgccccaggtcctgctgatgaggtggcctctggac
aagacaaggggcacaggctctgatgcagtgcccagaggccttgccaggaggcctgccaaa
ggcaagcttgcaagccatggggaacccagacatcttaaagaatgcttccattgtcacaaa
tcaaatgagcttgccacaagcaagagaagattaagtcatcagccattacagtgggtggtg
gaaaattcggagcactcgcctgaagttgaagatgtgattaacagtgttcagttcatagca
gaaaacatgaagagccacaatgaaaccaaggaggtagaagatgactggaaatacgtggcc
atggtggtggacagagtatttctttgggtatttataattgtctgtgtatttggaactgca
gggctatttctacagccactacttgggaacacaggaaaatcttaa

DBGET integrated database retrieval system