KEGG   Homo sapiens (human): 8973Help
Entry
8973              CDS       T01001                                 

Gene name
CHRNA6, CHNRA6
Definition
(RefSeq) cholinergic receptor nicotinic alpha 6 subunit
  KO
K04808  nicotinic acetylcholine receptor alpha-6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Cisatracurium: D00759
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Nicotine (DG00994): D03365 D05156 D05157
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rocuronium bromide: D00765
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8973 (CHRNA6)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    8973 (CHRNA6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    8973 (CHRNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    8973 (CHRNA6)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   8973 (CHRNA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF1286
Motif
Other DBs
NCBI-GeneID: 8973
NCBI-ProteinID: NP_004189
OMIM: 606888
HGNC: 15963
Ensembl: ENSG00000147434
Vega: OTTHUMG00000165275
Pharos: Q15825(Tchem)
UniProt: Q15825
Position
8p11.21
AA seq 494 aa AA seqDB search
MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVV
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLD
KTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTA
GLFLQPLLGNTGKS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccagcaaggggcagggattccttcatgggggcttgtgtctctggctgtgtgtg
ttcacacctttctttaaaggctgtgtgggctgtgcaactgaggagaggctcttccacaaa
ctgttttctcattacaaccagttcatcaggcctgtggaaaacgtttccgaccctgtcacg
gtacactttgaagtggccatcacccagctggccaacgtggatgaagtaaaccagatcatg
gaaaccaatttgtggctgcgtcacatctggaatgattataaattgcgctgggatccaatg
gaatatgatggcattgagactcttcgcgttcctgcagataagatttggaagcccgacatt
gttctctataacaatgctgttggtgacttccaagtagaaggcaaaacaaaagctcttctt
aaatacaatggcatgataacctggactccaccagctatttttaagagttcctgccctatg
gatatcacctttttcccttttgatcatcaaaactgttccctaaaatttggttcctggacg
tatgacaaagctgaaattgatcttctaatcattggatcaaaagtggatatgaatgatttt
tgggaaaacagtgaatgggaaatcattgatgcctctggctacaaacatgacatcaaatac
aactgttgtgaagagatatacacagatataacctattctttctacattagaagattgccg
atgttttacacgattaatctgatcatcccttgtctctttatttcatttctaaccgtgttg
gtcttttaccttccttcggactgtggtgaaaaagtgacgctttgtatttcagtcctgctt
tctctgactgtgtttttgctggtcatcacagaaaccatcccatccacatctctggtggtc
ccactggtgggtgagtacctgctgttcaccatgatctttgtcacactgtccatcgtggtg
actgtgtttgtgttgaacatacactaccgcaccccaaccacgcacacaatgcccaggtgg
gtgaagacagttttcctgaagctgctgccccaggtcctgctgatgaggtggcctctggac
aagacaaggggcacaggctctgatgcagtgcccagaggccttgccaggaggcctgccaaa
ggcaagcttgcaagccatggggaacccagacatcttaaagaatgcttccattgtcacaaa
tcaaatgagcttgccacaagcaagagaagattaagtcatcagccattacagtgggtggtg
gaaaattcggagcactcgcctgaagttgaagatgtgattaacagtgttcagttcatagca
gaaaacatgaagagccacaatgaaaccaaggaggtagaagatgactggaaatacgtggcc
atggtggtggacagagtatttctttgggtatttataattgtctgtgtatttggaactgca
gggctatttctacagccactacttgggaacacaggaaaatcttaa

DBGET integrated database retrieval system