KEGG   Homo sapiens (human): 8976Help
Entry
8976              CDS       T01001                                 

Gene name
WASL, N-WASP, NWASP, WASPB
Definition
(RefSeq) WASP like actin nucleation promoting factor
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04520  Adherens junction
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8976 (WASL)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    8976 (WASL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8976 (WASL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    8976 (WASL)
   05132 Salmonella infection
    8976 (WASL)
   05131 Shigellosis
    8976 (WASL)
   05135 Yersinia infection
    8976 (WASL)
   05100 Bacterial invasion of epithelial cells
    8976 (WASL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8976 (WASL)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    8976 (WASL)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    8976 (WASL)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     8976 (WASL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 PBD WH2 DUF4918 PQQ
Motif
Other DBs
NCBI-GeneID: 8976
NCBI-ProteinID: NP_003932
OMIM: 605056
HGNC: 12735
Ensembl: ENSG00000106299
Vega: OTTHUMG00000157346
Pharos: O00401(Tbio)
UniProt: O00401
Structure
PDB: 

Position
7q31.32
AA seq 505 aa AA seqDB search
MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPP
PPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgtccagcagcagccgccgccgccgcggagggtcaccaacgtggggtccctg
ttgctcaccccgcaggagaacgagtccctcttcactttcctcggcaagaaatgtgtgact
atgtcttcagcagtggtgcagttatatgcagcagatcggaactgtatgtggtcaaagaag
tgcagtggtgttgcttgtcttgttaaggacaatccacagagatcttattttttaagaata
tttgacattaaggatgggaaactattgtgggaacaagagctatacaataactttgtatat
aatagtcctagaggatattttcatacctttgctggagatacttgtcaagttgctcttaat
tttgccaatgaagaagaagcaaaaaaatttcgaaaagcagttacagaccttttgggccgt
cgacaaaggaaatctgagaaaagacgagatcccccaaatggtcctaatctacccatggct
acagttgatataaaaaatccagaaatcacaacaaatagattttatggtccacaagtcaac
aacatctcccataccaaagaaaagaagaagggaaaagctaaaaagaagagattaaccaag
gcagatataggaacaccaagcaatttccagcacattggacatgttggttgggatccaaat
acaggctttgatctgaataatttggatccagaattgaagaatcttttcgatatgtgtgga
atctcagaggcacaacttaaagacagagaaacatcaaaagttatatatgactttattgaa
aaaacaggaggtgttgaagctgttaaaaatgaactgcggaggcaagcaccaccacctcca
ccaccatcaaggggagggccacctcctcctcctccccctccacacaactcaggtcctcct
cctcctcctgctaggggaagaggcgctcctcccccaccaccttcaagagctcccacagct
gcacctccaccaccgcctccttccaggccaagtgtagcagtccctccaccaccgccaaat
aggatgtaccctcctccacctccagcccttccctcctcagcaccttcagggcctccacca
ccacctccatctgtgttgggggtagggccagtggcaccacccccaccgcctccacctcca
cctcctcctgggccaccgcccccgcctggcctgccttctgatggggaccatcaggttcca
actactgcaggaaacaaagcagctcttttagatcaaattagagagggtgctcagctaaaa
aaagtggagcagaacagtcggccagtgtcctgctctggacgagatgcactgttagaccag
atacgacagggtatccaactaaaatctgtggctgatggccaagagtctacaccaccaaca
cctgcacccacttcaggaattgtgggtgcattaatggaagtgatgcagaaaaggagcaaa
gccattcattcttcagatgaagatgaagatgaagatgatgaagaagattttgaggatgat
gatgagtgggaagactga

DBGET integrated database retrieval system