KEGG   Homo sapiens (human): 89777
Entry
89777             CDS       T01001                                 

Gene name
SERPINB12, YUKOPIN
Definition
(RefSeq) serpin family B member 12
  KO
K13966  serpin B11/12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    89777 (SERPINB12)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   89777 (SERPINB12)
SSDB
Motif
Pfam: Serpin Flu_B_NS1
Other DBs
NCBI-GeneID: 89777
NCBI-ProteinID: NP_536722
OMIM: 615662
HGNC: 14220
Ensembl: ENSG00000166634
Vega: OTTHUMG00000132789
Pharos: Q96P63(Tbio)
UniProt: Q96P63
Position
18q21.33
AA seq 405 aa
MDSLVTANTKFCFDLFQEIGKDDRHKNIFFSPLSLSAALGMVRLGARSDSAHQIDEVLHF
NEFSQNESKEPDPCLKSNKQKAGSLNNESGLVSCYFGQLLSKLDRIKTDYTLSIANRLYG
EQEFPICQEYLDGVIQFYHTTIESVDFQKNPEKSRQEINFWVECQSQGKIKELFSKDAIN
AETVLVLVNAVYFKAKWETYFDHENTVDAPFCLNANENKSVKMMTQKGLYRIGFIEEVKA
QILEMRYTKGKLSMFVLLPSHSKDNLKGLEELERKITYEKMVAWSSSENMSEESVVLSFP
RFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQAA
AATGAVVSERSLRSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggactctcttgttacagcaaacaccaaattttgctttgatctttttcaagagataggc
aaagatgatcgtcataaaaacatatttttctctcccctgagcctctcagctgcccttggt
atggtacgcttgggtgctagaagtgacagtgcacatcagattgatgaggtactacacttc
aacgaattttcccagaatgaaagcaaagaacctgacccttgtctgaaaagcaacaaacaa
aaagctgggtccttaaacaatgagagcggactggtcagctgctactttgggcagcttctc
tccaaattagacaggatcaagactgattacacactgagtattgccaacaggctttatgga
gagcaggaattcccaatctgtcaggaatacttagatggtgtgattcaattttaccacacg
acgattgaaagtgttgatttccaaaaaaaccctgaaaaatccagacaagagattaacttc
tgggttgaatgtcaatcccaaggtaaaatcaaggaactcttcagcaaggacgctattaat
gctgagactgtgctggtactggtgaatgctgtttacttcaaggccaaatgggaaacatac
tttgaccatgaaaacacggtggatgcacctttctgtctaaatgcgaatgaaaacaagagt
gtgaagatgatgacgcaaaaaggcctctacagaattggcttcatagaggaggtgaaggca
cagatcctggaaatgaggtacaccaaggggaagctcagcatgttcgtgctgctgccatct
cactctaaagataacctgaagggtctggaagagcttgaaaggaaaatcacctatgaaaaa
atggtggcctggagcagctcagaaaacatgtcagaagaatcggtggtcctgtccttcccc
cggttcaccctggaagacagctatgatctcaattccattttacaagacatgggcattacg
gatatctttgatgaaacgagggctgatcttactggaatctctccaagtcccaatttgtac
ttgtcaaaaattatccacaaaacctttgtggaggtggatgaaaacggtacccaggcagct
gcagccactggggctgttgtctcggaaaggtcactacgatcttgggtggagtttaatgcc
aaccacccttttctctttttcattagacacaacaaaacccaaaccattctcttttatggc
agggtctgctctccttaa

DBGET integrated database retrieval system