KEGG   Homo sapiens (human): 89795
Entry
89795             CDS       T01001                                 
Symbol
NAV3, POMFIL1, STEERIN3, unc53H3
Name
(RefSeq) neuron navigator 3
  KO
K23919  neuron navigator 3
Organism
hsa  Homo sapiens (human)
Disease
H01463  Mycosis fungoides
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    89795 (NAV3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     89795 (NAV3)
SSDB
Motif
Pfam: CH AAA nSTAND3 AAA_14 AAA_22 CAMSAP_CH RNA_helicase AAA_18 AAA_16 PhoH CH_2 AAA_28 ResIII Mg_chelatase AAA_25 IstB_IS21 NACHT AAA_7 AAA_19 ABC_tran AAA_24 AAA_2 AAA_5 DUF1993
Other DBs
NCBI-GeneID: 89795
NCBI-ProteinID: NP_001019554
OMIM: 611629
HGNC: 15998
Ensembl: ENSG00000067798
UniProt: Q8IVL0
Position
12:77571862..78213010
AA seq 2385 aa
MPVLGVASKLRQPAVGSKPVHTALPIPNLGTTGSQHCSSRPLELTETESSMLSCQLALKS
TCEFGEKKPLQGKAKEKEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQII
ANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLS
RYKQQQHHQQQYYQSLVELQQRVTHASPPSEASQAKTQQDMQSSLAARYATQSNHSGIAT
SQKKPTRLPGPSRVPAAGSSSKVQGASNLNRRSQSFNSIDKNKPPNYANGNEKDSSKGPQ
SSSGVNGNVQPPSTAGQPPASAIPSPSASKPWRSKSMNVKHSATSTMLTVKQSSTATSPT
PSSDRLKPPVSEGVKTAPSGQKSMLEKFKLVNARTALRPPQPPSSGPSDGGKDDDAFSES
GEMEGFNSGLNSGGSTNSSPKVSPKLAPPKAGSKNLSNKKSLLQPKEKEEKNRDKNKVCT
EKPVKEEKDQVTEMAPKKTSKIASLIPKGSKTTAAKKESLIPSSSGIPKPGSKVPTVKQT
ISPGSTASKESEKFRTTKGSPSQSLSKPITMEKASASSCPAPLEGREAGQASPSGSCTMT
VAQSSGQSTGNGAVQLPQQQQHSHPNTATVAPFIYRAHSENEGTALPSADSCTSPTKMDL
SYSKTAKQCLEEISGEDPETRRMRTVKNIADLRQNLEETMSSLRGTQISHSTLETTFDST
VTTEVNGRTIPNLTSRPTPMTWRLGQACPRLQAGDAPSLGAGYPRSGTSRFIHTDPSRFM
YTTPLRRAAVSRLGNMSQIDMSEKASSDLDMSSEVDVGGYMSDGDILGKSLRTDDINSGY
MTDGGLNLYTRSLNRIPDTATSRDIIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNISTD
DLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGK
WKTVSSGLPEDPEKAGQKASLSVSQTGSWRRGMSAQGGAPSRQKAGTSALKTPGKTDDAK
ASEKGKAPLKGSSLQRSPSDAGKSSGDEGKKPPSGIGRSTATSSFGFKKPSGVGSSAMIT
SSGATITSGSATLGKIPKSAAIGGKSNAGRKTSLDGSQNQDDVVLHVSSKTTLQYRSLPR
PSKSSTSGIPGRGGHRSSTSSIDSNVSSKSAGATTSKLREPTKIGSGRSSPVTVNQTDKE
KEKVAVSDSESVSLSGSPKSSPTSASACGAQGLRQPGSKYPDIASPTFRRLFGAKAGGKS
ASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTT
DVISLSHSLASSPASVHSFTSGGLVWAANMSSSSAGSKDTPSYQSMTSLHTSSESIDLPL
SHHGSLSGLTTGTHEVQSLLMRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQANQEEG
KEWLRSHSTGGLQDTGNQSPLVSPSAMSSSAAGKYHFSNLVSPTNLSQFNLPGPSMMRSN
SIPAQDSSFDLYDDSQLCGSATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYS
TAEEKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTA
EQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSAT
SHSSIGSGNDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSL
PASPKLPHNAGDCGSASMKPSQSASASPLVWPPKKRQNGPVIYKHRSRICECTEAEAEII
LQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTA
KPTRPPSESSSSTSSSSSRQSLGLSLNNLNITEAVSSDILLDDAGDATGHKDGRSVKIIV
SISKGYGRAKDQKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSTSLGLSSDC
IASYCIGDLIRSHNLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVFDTLIPKPITQ
RYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQ
QYLANLAEQCSADNNGVELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGV
SSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKT
WHHLNSFLETHSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMY
GKRTPWEDPSKWVLDTYPWSSATLPQESPALLQLRPEDVGYESCTSTKEATTSKHIPQTD
TEGDPLMNMLMKLQEAANYSSTQSCDSESTSHHEDILDSSLESTL
NT seq 7158 nt   +upstreamnt  +downstreamnt
atgcctgttcttggggttgcctcaaaactgaggcagccagctgttgggtcaaagcctgtg
catactgctcttccgataccaaatcttggcactactgggtcacagcactgttcttcaaga
cctttggaacttactgaaacagagagctccatgctttcttgtcagcttgcgttaaaatca
acctgtgaatttggagagaagaaacccctccaaggaaaagccaaggagaaagaagacagc
aagatttacactgactgggccaaccactacctagcaaaatcaggccacaagcggctgatc
aaggacttgcaacaagacattgcagatggagtactcctagcagaaatcatccagattatt
gcaaatgaaaaagttgaagatatcaatggatgtcctagaagtcagtctcagatgattgaa
aatgttgatgtctgccttagttttctagcagccagaggggtaaatgttcaaggtctatct
gctgaagaaataagaaatggaaacttaaaagccattctagggctgtttttcagtttatct
cgctacaagcagcaacaacaccatcaacaacagtactatcagtccttggtggaacttcag
cagcgagttactcacgcttcccctccatcggaagccagccaggccaaaacccagcaagat
atgcagtccagtctggcagccagatatgcaactcagtctaatcacagtggaattgcaacc
agtcaaaaaaagcctactaggcttccagggccctctagggtgcctgctgcaggaagcagc
agcaaggtccagggagcctctaatttaaataggagaagtcagagctttaacagcattgac
aaaaacaagcctccaaattatgcaaatggaaacgaaaaagattcctccaaaggacctcaa
tcgtcttcaggtgtaaatggtaacgtgcagcctcccagtactgctgggcagcctcctgcc
tctgccatcccttctccaagtgccagcaagccctggcgcagcaagtccatgaatgtcaaa
cacagtgccacctccaccatgttgactgtaaagcagtcaagtacagccacctcccccaca
ccatcttcagacagactgaagccacctgtctcagaaggggtcaaaactgctccctcagga
cagaaatccatgcttgagaaattcaagctagtcaatgcccggactgctttacgccccccg
cagcctcccagttcaggacctagtgatggtgggaaggatgatgatgccttttctgaatct
ggtgaaatggaaggttttaacagtggtctgaatagtggtggctcaacaaatagcagtccc
aaagtgtcacctaagttggcccctccaaaagctggaagcaaaaatctcagcaataaaaag
tctttgctacagccaaaggaaaaagaagaaaagaacagggacaaaaataaagtttgcact
gaaaaaccagtcaaagaagagaaggatcaggtgacagagatggctccaaaaaagacctcc
aaaattgcaagcttgatccctaagggcagcaagacaacagcagctaagaaggaaagctta
attccgtcttccagtggtattccaaaaccaggctctaaagttccaacagtaaagcaaacc
atttcacctggcagcacagcaagcaaagagtctgagaaattcaggactaccaaggggagc
ccttcccagtccttatctaagcctataaccatggagaaagcaagtgcttctagttgtcct
gcccctttggaaggaagggaagctggccaagcttctccttctggttcctgtaccatgaca
gtggcacaaagcagtgggcagagcacaggaaatggtgctgtccaactccctcaacagcag
caacatagccacccgaataccgcgacagtggcaccattcatttacagggcacattcagaa
aatgaaggtaccgctttaccatcggctgactcctgtaccagtcctacaaagatggactta
tcatatagtaagactgctaagcagtgcctggaggagatatctggtgaagaccctgaaaca
agaagaatgagaacagttaaaaacatagcagacttgaggcagaatttagaagagactatg
tccagtcttcgtgggactcagataagccacagcaccctggagacaacatttgacagcact
gtgacaacagaagttaatggaaggaccatacccaacttgacaagtcgacccacccccatg
acctggaggttgggccaggcatgtccgcgacttcaggcgggagatgctccctccctgggt
gctggctatcctcgcagtggtaccagtcgattcatccacacagacccctcgaggttcatg
tataccacgcctctccgtcgagctgctgtctctaggctgggaaacatgtcacagattgac
atgagtgagaaagcaagcagtgacctggacatgtcttctgaggtcgatgtgggtggatat
atgagtgatggtgatatccttgggaaaagtctcaggactgatgacatcaacagtgggtac
atgacagatggaggacttaacctatatactagaagtctgaaccgaataccagacacagca
acttcccgggacatcatccagagaggggttcacgatgtgacagtggatgcagacagctgg
gatgacagcagttcagtgagcagtggtctcagtgacacccttgataacatcagcactgat
gacctgaacaccacatcctctgtcagctcttactccaacatcaccgtcccctctaggaag
aatactcagctgaggacagattcagagaaacgctccaccacagacgagacctgggatagt
cctgaggaactgaaaaaaccagaagaagattttgacagccatggggatgctggtggcaag
tggaagactgtgtcctctggacttcctgaagaccccgagaaggcagggcagaaagcttcc
ctgtctgtttcacagacaggttcctggagaagaggcatgtctgcccaaggaggggcgcca
tctaggcagaaagctggaacaagtgcactcaaaacacccgggaaaaccgatgatgccaaa
gcttctgagaaaggaaaagctcccctaaaaggatcatctctacaaagatctccttcagat
gcaggaaaaagcagtggagatgaagggaaaaagcccccctcaggcattggaagatcgact
gccaccagctcctttggctttaagaaaccaagtggagtagggtcatctgccatgatcacc
agcagtggagcaaccataacaagtggctctgcaacactgggtaaaattccaaaatctgct
gccattggcgggaagtcaaatgcagggagaaaaaccagtttggacggttcacagaatcag
gatgatgttgtgctgcatgttagctcaaagactaccctacaatatcgcagcttgccccgc
ccttcaaaatccagcaccagtggcattcctggccgaggaggccacagatccagtaccagc
agtattgattccaacgtcagcagcaagtctgctggggccaccacctcgaaactgagagaa
ccaactaaaattgggtcagggcgctcgagtcctgtcaccgtcaaccaaacagacaaggaa
aaggaaaaagtagcagtctcagattcagaaagtgtttctttgtcaggttcccccaaatcc
agccccacctctgccagcgcctgtggtgcacaaggtctcaggcagccaggatccaagtat
ccagatattgcctcacccacatttcgaaggttgtttggtgccaaggcaggtggcaaatct
gcctctgcacctaatactgagggtgtgaaatcttcctcagtaatgcccagccctagtacc
acattagcgcggcaaggcagtctggagtcaccgtcgtccggtacgggcagcatgggcagt
gctggtgggctaagcggcagcagcagccctctcttcaataaaccctcagacttaactaca
gatgttataagcttaagtcactcgttggcctccagcccagcatcggttcactctttcaca
tcaggtggtctcgtgtgggctgccaatatgagcagttcctctgcaggcagcaaggatact
ccgagctaccagtccatgactagcctccacacgagctctgagtccattgacctccccctc
agccatcatggctccttgtctggactgaccacaggcactcacgaggtccagagcctgctc
atgagaacgggtagtgtgagatctactctctcagaaagcatgcagcttgacagaaataca
ctacccaaaaagggactaagatataccccatcatctcggcaggccaaccaagaagagggc
aaagagtggttgcgttctcattctactggagggcttcaggacactggcaaccagtcacct
ctggtttccccttctgccatgtcatcttctgcagctggaaaataccacttttctaacttg
gtgagcccaacaaatttgtctcagtttaaccttcccgggcccagcatgatgcgctcaaac
agcatcccagcccaagactcttccttcgatctctatgatgactcccagctttgtgggagt
gccacttctctggaggaaagacctcgtgccatcagtcattcgggctcattcagagacagc
atggaagaagttcatggctcttcattatcactggtgtccagcacttcttctctttactct
acagctgaagaaaaggctcattcagagcaaatccataaactgcggagagagctggttgca
tcacaagaaaaagttgctaccctcacatctcagctttcagcaaatgctcaccttgtagca
gcttttgaaaagagcttagggaatatgactggccgattgcaaagtctaactatgacagcg
gaacaaaaggaatctgaacttatagaactaagagaaaccattgaaatgctgaaggctcag
aattctgctgcccaggcggctattcagggagcactgaatggtccagaccatcctcccaaa
gatcttcgcatcagaagacagcattcctctgaaagtgtttctagtatcaacagtgccaca
agccattccagtattggcagtggtaatgatgccgactccaagaagaagaaaaagaaaaac
tgggtgaactctagaggaagtgagctgagaagttctttcaaacaagcctttgggaagaaa
aagtccaccaagcctccttcatcacattctgacattgaagagcttactgattcatccctt
ccggcatcccccaagttaccccataatgctggtgactgtggctcagcatccatgaagccc
tcacaatctgcttcagcgtcaccccttgtctggccaccaaagaaacgacaaaatggccct
gtgatctacaagcatagatctcggatctgtgaatgcacagaagctgaggcagagataatt
ctgcagctgaagagcgagctcagagaaaaggaattaaaattaacggatattcggctggag
gccctcagctctgctcatcatcttgatcagatccgggaagccatgaaccggatgcagaat
gaaattgaaatactgaaagctgaaaatgaccggttgaaggcagaaactggtaacacagct
aagcctactcggccaccgtcagaatcctcaagcagcacctcctcttcatcttccaggcag
tcattaggactttctctaaacaatttgaacatcacagaggctgttagctcagatattttg
ctagatgatgctggtgatgcaactggacataaagatggccgcagtgtgaaaattatagtc
tccataagcaagggctatggtcgagcaaaggaccaaaaatctcaggcatatttgatagga
tccattggtgttagtggaaaaaccaagtgggatgtcttagatggtgtaataagacgtctc
tttaaggaatatgtattccgaattgatacatccactagccttggtctgagctctgactgc
attgctagctactgtataggagacttaattagatcccataacctagaagtgcctgaattg
ctgccttgtggataccttgttggagataataacatcatcactgtgaacctcaaaggggta
gaagaaaatagtttggacagttttgtttttgatacgctgattcctaaaccaattacccaa
aggtactttaacttgttgatggagcatcacagaattatactctcaggaccgagtggtact
ggaaagacctatttggcaaacaaacttgctgaatatgtaataaccaaatctggaaggaaa
aaaacagaggatgcaattgccacttttaatgtggaccacaagtcaagtaaggaattgcaa
caatatctagctaacctggctgaacagtgcagtgctgataataatggagtggagctccca
gttgtaataattcttgataatcttcatcatgtgggctctctgagtgatatcttcaatggt
tttctcaattgtaaatacaacaaatgtccatatattattggaacaatgaatcagggagtt
tcttcatcaccaaatctagagctgcatcacaatttcaggtgggtattatgtgcaaatcat
acagaaccagtgaaaggctttttaggcagatatcttcgaagaaaactcatagagatagaa
attgaaaggaacattcgcaataatgacctagtcaaaattatagattggattccgaagacg
tggcatcatctcaacagttttttggaaacacacagttcttctgacgttaccattggtccc
cgactattccttccttgccccatggatgtagaaggttctagagtatggttcatggatctc
tggaactattctttagtaccttatattctggaggcagtgagagagggtcttcagatgtat
gggaaacgcacaccatgggaagatccttcaaagtgggtgcttgacacatatccatggagc
tcagcaactctgcctcaggagagcccagccttacttcagctgcgaccagaagatgttggg
tatgaaagctgcacatccactaaggaagccacaacctcaaagcacattccgcaaactgac
acagaaggagatcccctgatgaatatgctaatgaaactccaagaagcagccaattactcg
agcacacaaagctgcgacagcgaaagcaccagccaccatgaagacattttggattcatct
cttgaatctaccctctag

DBGET integrated database retrieval system