KEGG   Homo sapiens (human): 89797
Entry
89797             CDS       T01001                                 
Symbol
NAV2, HELAD1, POMFIL2, RAINB1, STEERIN2, UNC53H2
Name
(RefSeq) neuron navigator 2
  KO
K19483  neuron navigator 2 [EC:5.6.2.4]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    89797 (NAV2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     89797 (NAV2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    89797 (NAV2)
SSDB
Motif
Pfam: CH AAA_22 AAA nSTAND3 AAA_14 AAA_18 CAMSAP_CH AAA_16 AAA_28 AAA_24 PhoH CH_2 AAA_5 AAA_25 IstB_IS21 NACHT RNA_helicase ResIII BrxL_ATPase DUF4407 Nnf1 DUF6262 ABC_tran
Other DBs
NCBI-GeneID: 89797
NCBI-ProteinID: NP_001231892
OMIM: 607026
HGNC: 15997
Ensembl: ENSG00000166833
UniProt: Q8IVL1 A7E2D6
Structure
Position
11:19345236..20121601
AA seq 2488 aa
MPAILVASKMKSGLPKPVHSAAPILHVPPARAGPQPCYLKLGSKVEVSKTTYPSQIPLKS
QVLQGLQEPAGEGLPLRKSGSVENGFDTQIYTDWANHYLAKSGHKRLIRDLQQDVTDGVL
LAQIIQVVANEKIEDINGCPKNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAI
LGLFFSLSRYKQQQQQPQKQHLSSPLPPAVSQVAGAPSQCQAGTPQQQVPVTPQAPCQPH
QPAPHQQSKAQAEMQSSASSKDSSQSKIIRFTLGQKKISRLPGPTARVSAAGSEAKTRGG
STTANNRRSQSFNNYDKSKPVTSPPPPPSSHEKEPLASSASSHPGMSDNAPASLESGSSS
TPTNCSTSSAIPQPGAATKPWRSKSLSVKHSATVSMLSVKPPGPEAPRPTPEAMKPAPNN
QKSMLEKLKLFNSKGGSKAGEGPGSRDTSCERLETLPSFEESEELEAASRMLTTVGPASS
SPKIALKGIAQRTFSRALTNKKSSLKGNEKEKEKQQREKDKEKSKDLAKRASVTERLDLK
EEPKEDPSGAAVPEMPKKSSKIASFIPKGGKLNSAKKEPMAPSHSGIPKPGMKSMPGKSP
SAPAPSKEGERSRSGKLSSGLPQQKPQLDGRHSSSSSSLASSEGKGPGGTTLNHSISSQT
VSGSVGTTQTTGSNTVSVQLPQPQQQYNHPNTATVAPFLYRSQTDTEGNVTAESSSTGVS
VEPSHFTKTGQPALEELTGEDPEARRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETT
FDTNVTTEMSGRSILSLTGRPTPLSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTE
SGRYVYSAPLRRQLASRGSSVCHVDVSDKAGDEMDLEGISMDAPGYMSDGDVLSKNIRTD
DITSGYMTDGGLGLYTRRLNRLPDGMAVVRETLQRNTSLGLGDADSWDDSSSVSSGISDT
IDNLSTDDINTSSSISSYANTPASSRKNLDVQTDAEKHSQVERNSLWSGDDVKKSDGGSD
SGIKMEPGSKWRRNPSDVSDESDKSTSGKKNPVISQTGSWRRGMTAQVGITMPRTKPSAP
AGALKTPGTGKTDDAKVSEKGRLSPKASQVKRSPSDAGRSSGDESKKPLPSSSRTPTANA
NSFGFKKQSGSAAGLAMITASGVTVTSRSATLGKIPKSSALVSRSAGRKSSMDGAQNQDD
GYLALSSRTNLQYRSLPRPSKSNSRNGAGNRSSTSSIDSNISSKSAGLPVPKLREPSKTA
LGSSLPGLVNQTDKEKGISSDNESVASCNSVKVNPAAQPVSSPAQTSLQPGAKYPDVASP
TLRRLFGGKPTKQVPIATAENMKNSVVISNPHATMTQQGNLDSPSGSGVLSSGSSSPLYS
KNVDLNQSPLASSPSSAHSAPSNSLTWGTNASSSSAVSKDGLGFQSVSSLHTSCESIDIS
LSSGGVPSHNSSTGLIASSKDDSLTPFVRTNSVKTTLSESPLSSPAASPKFCRSTLPRKQ
DSDPHLDRNTLPKKGLRYTPTSQLRTQEDAKEWLRSHSAGGLQDTAANSPFSSGSSVTSP
SGTRFNFSQLASPTTVTQMSLSNPTMLRTHSLSNADGQYDPYTDSRFRNSSMSLDEKSRT
MSRSGSFRDGFEEESWEKSSVDNFVSRLHSSLHFSLPLFHHARYELVHGSSLSLVSSTSS
VYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQSLTM
TAEQKDSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGTAQSADLRIRRQHSS
DSVSSINSATSHSSVGSNIESDSKKKKRKNWVNELRSSFKQAFGKKKSPKSASSHSDIEE
MTDSSLPSSPKLPHNGSTGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTD
IRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVSISASPRQ
SMGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEEMKWKEDSRPHLFLI
GCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGEIKRSNTSETPE
LLPCGYLVGENTTISVTVKGLAENSLDSLVFESLIPKPILQRYVSLLIEHRRIILSGPSG
TGKTYLANRLSEYIVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNSENNAVDM
PLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCAN
HTEPVKGFLGRFLRRKLMETEISGRVRNMELVKIIDWIPKVWHHLNRFLEAHSSSDVTIG
PRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDTYPW
AASPQQHEWPPLLQLRPEDVGFDGYSMPREGSTSKQMPPSDAEGDPLMNMLMRLQEAANY
SSPQSYDSDSNSNSHHDDILDSSLESTL
NT seq 7467 nt   +upstreamnt  +downstreamnt
atgccggccatcctggtcgcctccaaaatgaagtcgggactgcccaaacccgtgcacagc
gccgcgcccatcctgcacgtgcccccggcccgggcgggcccccagccctgctacctgaag
ttgggaagcaaggtggaggtgagcaagaccacctatcctagccagatccccctgaaatcg
caggtgctgcaggggctgcaggagccagcgggggaggggctcccgctgcggaagagcggc
tcggtggaaaacgggttcgatacccagatctacacagactgggccaatcattacctagcc
aaatccggccacaagcgtctcatcagggatctccagcaagatgtgacagatggcgtcctc
ctggcccagattatccaggttgtggcaaatgaaaagattgaagacatcaatggctgtccg
aagaacagatcccaaatgattgaaaacatagatgcctgcttgaatttcctggcagctaag
ggaataaacatccaggggctgtctgcagaagagatcaggaatggaaacctcaaggccatt
ctaggcctcttcttcagcctctcccgatacaagcagcagcagcagcagccccagaagcag
cacctctcctcacctctgccgcccgccgtatcccaggtggccggggccccctcccagtgc
caggctggcacccctcagcagcaggtgccagtcactccccaagccccgtgccagcctcac
cagccagcgccacatcagcagtcaaaagcacaagctgaaatgcagtccagtgcatcatcc
aaggactcatctcaaagcaaaatcatccgcttcactctgggtcagaaaaagatctctaga
cttccaggtcctaccgcgagggtatccgctgcaggcagcgaggccaaaacacgcggaggg
tcaactactgctaacaaccgacgcagccagagctttaacaactatgataaatccaaacca
gtcacctccccacccccaccgccaagcagccacgagaaagagcctttggcaagttcagcc
tcctcccaccccggaatgagtgacaatgcacctgcttccttggagagcggcagcagctcc
acccctactaattgcagtacctcctcggccatcccgcagcccggtgcagccaccaagcct
tggcgcagcaaatccctcagcgtgaagcacagtgccacggtatccatgctctcggtcaag
cctcctgggcctgaggcccccaggcccacacctgaagccatgaagccggcccccaacaat
cagaagtccatgctggaaaagctgaaacttttcaacagtaaagggggctcaaaggcaggt
gaggggccggggtcccgggacacaagctgtgagcggctggagactctgcccagcttcgaa
gagagcgaggagctggaggccgccagtcgcatgctcaccaccgtgggccctgcttccagc
agccccaagattgcactcaagggcattgcccagaggacttttagccgggcactgaccaac
aagaagagttctctgaaaggcaatgagaaagagaaggagaaacaacagcgggagaaggat
aaggagaaaagcaaggaccttgccaagagagcctctgtgacggagaggctggacctcaag
gaggagccaaaagaagaccccagtggagcagctgtgcccgagatgccaaaaaagtcctcc
aagattgccagcttcatccccaaaggggggaagctcaacagtgccaagaaggagcccatg
gccccttcccacagtggaataccaaaaccaggaatgaaaagcatgcccgggaaatcccca
agtgccccagcgccttccaaggaaggggagcggagccggagtgggaagctgagctcagga
ctcccccagcagaagccccagctggacggcagacactccagttcctcttccagcctggcg
tcctcagaaggaaaaggcccaggagggaccaccctgaaccacagcatcagcagccagact
gtcagtgggtctgtcgggaccacccagaccacaggaagcaataccgtcagtgttcagcta
cctcagccccagcagcaatacaaccatcccaacactgccacggttgcacctttcctgtac
aggtctcagacggacactgaagggaatgttactgccgagtcaagctcaacaggtgtgagc
gtggagcccagccacttcaccaagactggacagcctgctctggaagaactcactggggaa
gatcctgaggctcggcggctgcggacagtgaagaacatcgctgatctgcggcagaatttg
gaggaaaccatgtccagtttaaggggaactcaggttacacacagcacattggaaaccacg
tttgacaccaatgtcaccacggagatgagtggccgtagcatactcagcttgacagggagg
cccacacctctgtcctggagactgggccagtccagccctcggctccaagcaggagacgcc
ccctcaatgggcaatgggtatccccctcgagccaacgccagcaggttcatcaacactgag
tcaggtcgctatgtgtactccgcccctctgagaaggcagctggcctcccggggcagtagt
gtctgccatgtggacgtctcagacaaggcaggagatgagatggacctggaaggcatcagc
atggatgcccccggctacatgagcgacggggatgttctgagcaagaacatccggaccgat
gacattacaagcggatacatgactgatggtggacttggcctctatacccgtcgcctgaac
cggctccctgatgggatggctgtggtacgggagaccctgcaacgaaatacctccctgggc
ctcggagacgctgacagctgggacgacagcagctccgtcagcagcggcatcagcgacacc
atagacaacctcagcactgatgacatcaacaccagctcctccatcagctcttatgccaac
acacctgcctcctctcgaaaaaacctggatgtgcagactgatgctgagaagcactcacag
gtggagaggaattccctgtggtctggtgatgatgtcaagaaatcagacggaggctcagac
agcggcataaaaatggagccaggttccaagtggaggcggaatccttctgatgtgtctgac
gagtccgacaaaagcacgtcgggcaagaagaatcctgtcatctcccagacaggctcatgg
cggcgaggcatgacagctcaggtgggcatcaccatgccaaggacgaagccttcagccccg
gcaggcgcactgaagaccccaggaactggaaaaacagacgacgcaaaggtgtctgagaaa
ggaaggctttctcctaaagcctcccaggtgaagcgctccccatcagatgcaggccggagc
agtggtgacgaatccaaaaagcccctccccagcagctctaggacacctactgccaatgcc
aacagctttgggttcaagaagcagagtggttccgccgccggcctggccatgatcacagcc
agcggggtgactgtcaccagcaggtcagccacactgggcaaaatcccaaagtcatctgca
ctcgtcagtcggtctgctggtcggaagtcaagtatggatggggctcagaatcaggatgac
gggtatctagccctaagctcccggacaaaccttcagtaccggagtttgccgaggcccagt
aagtccaacagccggaacggggctgggaacaggtctagcaccagcagcatagattccaac
attagcagcaagtccgcaggcctgccagtgcccaaactgagggagccttccaaaacagcc
ctaggcagctctctaccaggtctggtcaaccaaacagacaaggagaaaggcatctcatca
gacaacgagagtgtggcttcctgtaactcggtgaaagtgaatccggcagcccagcctgtg
tccagtccggctcagaccagtctccagcctggagccaagtacccagatgtggcctctccc
acactccgcagactctttggtgggaagcctaccaagcaagtgcccatcgccacagctgaa
aacatgaaaaattcggtggtcatctccaatcctcatgccaccatgactcagcaaggtaac
ctagactccccgtcaggcagtggcgtcctgagcagtgggagcagcagtcctctctacagc
aagaatgtggacctcaaccagtctccgctagcctccagccccagctcagcccactcggcc
ccttccaacagcctcacctggggcaccaacgccagcagctcctccgcagttagcaaggat
ggcctgggctttcagtctgtcagcagcctccacaccagctgtgagtccatcgacatctcc
ctcagcagtggaggggtccccagccacaattcttccactggcctcatcgcctcctccaag
gacgactccttgactccctttgtcagaactaacagtgtgaagaccacactgtcagaaagc
cctctctcttcccctgctgctagccctaagttctgcagaagtactctgcccaggaaacag
gacagtgacccgcaccttgataggaacactttgcctaagaaaggactcaggtatactccc
acctcccagcttcgcacgcaagaagatgcaaaagaatggttacggtcccattctgcagga
ggccttcaggacaccgctgccaattcccccttttcctctggctccagcgtgacttctccc
tccggaacaagattcaacttttcccagcttgcgagtcccaccactgtcacccagatgagc
ttgtccaacccgaccatgctgaggactcacagcctctccaatgctgatgggcagtatgat
ccatacactgacagccgcttccggaatagctccatgtccctggatgagaagagcagaacc
atgagccgttcaggctcattccgggatgggtttgaagaagaatcatgggagaaaagttct
gtggacaactttgtcagccgtcttcacagctcacttcatttctctcttcctttgttccat
cacgcaaggtatgagttagttcatggatcctcactctccttggtttccagcacatcgtca
gtttattctacaccagaagaaaaatgccagtcagagattcgcaagctgcggcgggaactg
gatgcctcccaggagaaagtttcagctttgaccacccagctgacagcaaatgctcacctt
gtggcagcctttgaacagagtcttggtaacatgacaatcaggctccagagtctgaccatg
acagctgagcagaaggactcagaactgaatgagttaagaaaaaccattgagctgctaaag
aaacagaacgcagctgcccaggctgccattaatggagtaattaacacacctgagctcaac
tgcaaaggaaacggcactgcccagtctgcagacctccgcatccgcaggcagcactcctca
gacagcgtctccagcatcaacagtgccaccagccactccagcgtgggcagcaacatagag
agtgactcaaagaagaagaagcggaagaactgggtcaatgagttacgcagctccttcaag
caagctttcgggaagaagaagtccccaaaatctgcgtcctctcattcagatattgaggag
atgacggattcttctttgccttcctcaccaaagttaccgcacaatgggtccacaggttcc
accccactgctgaggaattctcactccaactctctaatttcagaatgcatggatagtgaa
gctgagaccgtcatgcagctccgaaatgagttaagagacaaggagatgaagctgacggat
atccgcttagaagctctcagttctgcccaccagctggaccagctccgggaggccatgaac
aggatgcagagtgaaatagagaagctgaaagctgagaatgatcggctgaagtcagagtct
caaggcagtggctgcagccgggctccttcccaagtgtccatctctgcctccccgaggcag
tccatgggcctctcccagcacagcttgaacctcactgagtcaaccagcctggacatgttg
ctggatgacactggtgaatgctcggctcggaaggaaggaggcaggcatgttaagatagtt
gtcagctttcaggaggaaatgaagtggaaggaggattccagaccacatctctttcttatt
ggctgcattggagttagtggcaagacgaagtgggatgtgctcgatggggtggttagacgg
ctgttcaaagaatacatcattcatgtcgacccagtgagtcagctagggctgaattcagac
agcgttcttggctacagcattggagaaatcaagcgcagcaacacttccgaaacaccggag
ctgcttccttgtggctatctggttggagagaacacgaccatctcagtgactgtgaaaggg
ctcgcagaaaacagcctggactcactggtgtttgagtccttgattcccaagcccatcctg
cagcgctacgtctccctcctgatagagcaccgtcggatcattctctctggccccagcggc
actgggaaaacctacctggccaaccggctgtctgagtatatagtgcttcgagagggacgg
gagttgacagacggggttatcgccacctttaacgtggaccataagtccagcaaggaattg
cgccagtacctgtccaaccttgctgaccagtgcaacagtgagaacaatgctgtggacatg
cccctcgtcatcatcctggacaacctacaccacgtgagctctctgggagagatcttcaat
gggctgctcaactgcaagtaccacaaatgcccttacataattggcacaatgaaccaggct
acctcttcgactcccaacctgcagcttcaccataacttcagatgggtgctttgtgccaac
cacacggagcctgtgaagggtttccttggccgattcctgaggaggaagctcatggaaaca
gagatcagtgggcgggtgcgcaatatggagctggtaaaaatcattgactggattcccaag
gtctggcatcacctcaaccgcttcctggaggctcacagttcctcggacgtcaccatcggc
ccccggctcttcctgtcatgccccatcgatgtggacggctcgagagtgtggttcaccgac
ttgtggaactattccattatcccctatctcctggaagccgtcagagaaggactccagctc
tatggaaggcgcgccccctgggaggatcctgccaagtgggtgatggacacatatccatgg
gcagccagcccacaacagcacgagtggcctcccctgctgcagttacggcctgaggatgtc
ggcttcgacggctactccatgcctcgggagggatcgacaagcaagcagatgccccccagt
gatgctgaaggtgacccgctgatgaacatgctgatgaggctgcaggaggcagccaactac
tccagcccccagagctatgacagcgactccaacagcaacagccatcacgatgacatcttg
gactcctctttggagtccactctgtga

DBGET integrated database retrieval system