KEGG   Homo sapiens (human): 89858Help
Entry
89858             CDS       T01001                                 

Gene name
SIGLEC12, S2V, SIGLECL1, SLG, Siglec-XII
Definition
(RefSeq) sialic acid binding Ig like lectin 12 (gene/pseudogene)
  KO
K10079  sialic acid binding Ig-like lectin 12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    89858 (SIGLEC12)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  89858 (SIGLEC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 C2-set_2
Motif
Other DBs
NCBI-GeneID: 89858
NCBI-ProteinID: NP_443729
OMIM: 606094
HGNC: 15482
Ensembl: ENSG00000254521
Vega: OTTHUMG00000165524
Pharos: Q96PQ1(Tbio)
UniProt: Q96PQ1
Position
19q13.41
AA seq 595 aa AA seqDB search
MLLLLLLLPPLLCGRVGAKEQKDYLLTMQKSVTVQEGLCVSVLCSFSYPQNGWTASDPVH
GYWFRAGDHVSRNIPVATNNPARAVQEETRDRFHLLGDPQNKDCTLSIRDTRESDAGTYV
FCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESVTVQEGLCVSVPCSVLYPHYNW
TASSPVYGSWFKEGADIPWDIPVATNTPSGKVQEDTHGRFLLLGDPQTNNCSLSIRDARK
GDSGKYYFQVERGSRKWNYIYDKLSVHVTALTHMPTFSIPGTLESGHPRNLTCSVPWACE
QGTPPTITWMGASVSSLDPTITRSSMLSLIPQPQDHGTSLTCQVTLPGAGVTMTRAVRLN
ISYPPQNLTMTVFQGDGTASTTLRNGSALSVLEGQSLHLVCAVDSNPPARLSWTWGSLTL
SPSQSSNLGVLELPRVHVKDEGEFTCRAQNPLGSQHISLSLSLQNEYTGKMRPISGVTLG
AFGGAGATALVFLYFCIIFVVVRSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESP
ADDSPPHHAPPALATPSPEEGEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgctactgctgctgctactgctgccacccctgctctgtgggagagtgggggctaaggaa
cagaaggattacctgctgacaatgcagaagtccgtgacggtgcaggagggcctgtgtgtc
tctgtgctttgctccttctcctacccccaaaatggctggactgcctccgatccagttcat
ggctactggttccgggcaggggaccatgtaagccggaacattccagtggccacaaacaac
ccagctcgagcagtgcaggaggagactcgggaccgattccacctccttggggacccacag
aacaaggattgtaccctgagcatcagagacaccagagagagtgatgcagggacatacgtc
ttttgtgtagagagaggaaatatgaaatggaattataaatatgaccagctctctgtgaat
gtgacagcgtcccaggacctactgtcaagatacaggctggaggtgccagagtcggtgact
gtgcaggagggtctgtgtgtctctgtgccctgcagtgtcctttacccccattacaactgg
actgcctctagccctgtttatggatcctggttcaaggaaggggccgatataccatgggat
attccagtggccacaaacaccccaagtggaaaagtgcaagaggatacccacggtcgattc
ctcctccttggggacccacagaccaacaactgctccctgagcatcagagatgccaggaag
ggggattcagggaagtactacttccaggtggagagaggaagcaggaaatggaactacata
tatgacaagctctctgtgcatgtgacagccctgactcacatgcccaccttctccatcccg
gggaccctggagtctggccaccccaggaacctgacctgctctgtgccctgggcctgtgaa
caggggacgccccccacgatcacctggatgggggcctccgtgtcctccctggaccccact
atcactcgctcctcgatgctcagcctcatcccacagccccaggaccatggcaccagcctc
acctgtcaggtgaccttgcctggggccggcgtgaccatgaccagggctgtccgactcaac
atatcctatcctcctcagaacttgaccatgactgtcttccaaggagatggcacagcatcc
acaaccttgaggaatggctcggccctttcagtcctggagggccagtccctgcaccttgtc
tgtgctgtcgacagcaatccccctgccaggctgagctggacctgggggagcctgaccctg
agcccctcacagtcctcgaaccttggggtgctggagctgcctcgagtgcatgtgaaggat
gaaggggaattcacctgccgagctcagaaccctctaggctcccagcacatttccctgagc
ctctccctgcaaaacgagtacacaggcaaaatgaggcctatatcaggagtgacgctaggg
gcattcgggggagctggagccacagccctggtcttcctgtacttctgcatcatcttcgtt
gtagtgaggtcctgcaggaagaaatcggcaaggccagcagtgggcgtgggggatacaggc
atggaggacgcaaacgctgtcaggggctcagcctctcagggacccctgattgaatccccg
gcagatgacagccccccacaccatgctccgccagccctggccaccccctccccagaggaa
ggagagatccagtatgcatccctcagcttccacaaagcgaggcctcagtacccacaggaa
caggaggccatcggctatgagtactccgagatcaacatccccaagtga

DBGET integrated database retrieval system