KEGG   Homo sapiens (human): 8986Help
Entry
8986              CDS       T01001                                 

Gene name
RPS6KA4, MSK2, RSK-B, S6K-alpha-4
Definition
(RefSeq) ribosomal protein S6 kinase A4
  KO
K16510  ribosomal protein S6 kinase alpha-4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04668  TNF signaling pathway
Network
N00444  TNF-p38 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    8986 (RPS6KA4)
   04668 TNF signaling pathway
    8986 (RPS6KA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8986 (RPS6KA4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8986 (RPS6KA4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   8986 (RPS6KA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Kdo RIO1 Pkinase_C FTA2 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 8986
NCBI-ProteinID: NP_003933
OMIM: 603606
HGNC: 10433
Ensembl: ENSG00000162302
Vega: OTTHUMG00000046094
Pharos: O75676(Tchem)
UniProt: O75676 A0PJF8
Position
11q13.1
AA seq 772 aa AA seqDB search
MGDEDDDESCAVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKTGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVNLHEVHHDQLHTY
LVLELLRGGELLEHIRKKRHFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPGVPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRGSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgaggacgacgatgagagctgcgccgtggagctgcggatcacagaagccaac
ctgaccgggcacgaggagaaggtgagcgtggagaacttcgagctgctcaaggtgctgggc
acgggagcctacggcaaggtgttcctggtgcggaaggcgggcgggcacgacgcggggaag
ctgtacgccatgaaggtgctgcgcaaggcggcgctggtgcagcgcgccaagacgcaagag
cacacgcgcaccgagcgctcggtgctggagctggtgcgccaggcgcccttcctggtcacg
ctgcactacgctttccagacggatgccaagctgcacctcatcctggactatgtgagcggc
ggggagatgttcacccacctctaccagcgccagtacttcaaggaggctgaggtgcgcgtg
tatgggggtgagatcgtgctggccctggaacacctgcacaagctcggcatcatttaccga
gacctgaaactggagaatgtgctgctggactccgagggccacattgtcctcacggacttc
gggctgagcaaggagttcctgacggaggagaaagagcggaccttctccttctgtggcacc
atcgagtacatggcccccgaaatcatccgtagcaagacggggcatggcaaggctgtggac
tggtggagcctgggcatcttgctcttcgagctgctgacgggggcctcgcccttcaccctg
gagggcgagaggaacacgcaggctgaggtgtctcgacggatcctgaagtgctcccctccc
ttcccccctcggatcgggcccgtggcgcaggacctgctgcagcggctgctttgtaaggat
cctaagaagcgattgggcgcggggccccagggggcacaagaagtccggaaccatcccttc
ttccagggcctcgattgggtggctctggctgccaggaagattccagccccattccggccc
caaatccgctcagagctggatgtgggcaactttgcggaggaattcactcggctggagcct
gtctactcaccccctggcagccccccacctggggacccccgaatctttcagggatactcc
tttgtggcaccctccattctctttgaccacaacaacgcggtgatgaccgatgggctggaa
gcgcctggtgctggagaccggccaggtcgggcagcggtggccaggagcgctatgatgcag
gactcgcccttcttccagcagtacgagctggacctgcgggagcctgcgctgggccagggc
agcttttctgtgtgtcgccgctgccgccagcgccagagcggccaggagttcgcagtcaag
atcctcagtcgcaggctggaggcgaacacgcagcgcgaagtggctgccctgcgcctgtgc
cagtcacaccccaacgtggtgaatctgcacgaggtgcatcacgaccagctgcacacgtac
ctggtcctggagctgctgcggggcggggagctgctggagcacatccgcaagaagcggcac
ttcagcgagtcggaagcaagccagatcctgcgcagcctcgtgtcggccgtgagcttcatg
cacgaggaggcgggcgtggtgcaccgcgacctcaagccggagaacatcctgtacgccgac
gacacgcccggggccccggtgaaaatcatcgacttcgggttcgcgcggttgcggccgcag
agtcccggggtgcccatgcagacgccctgcttcacgctgcagtacgctgcccccgagctg
ctggcgcagcagggctacgacgagtcctgcgacctctggagcctgggcgtcattctgtac
atgatgctgtcggggcaggtccccttccagggggcctctggccagggcgggcagagccag
gcggccgagatcatgtgcaaaatccgcgaggggcgcttctcccttgacggggaggcctgg
cagggtgtatccgaggaagccaaggagctggtccgagggctcctgaccgtggaccccgcc
aagcggctgaagctcgagggactgcggggcagctcgtggctgcaggacggcagcgcgcgc
tcctcgcccccgctccggacgcccgacgtgctcgagtcctctgggcccgcagtgcgctcg
ggtctcaacgccaccttcatggcattcaaccggggcaagcgggagggcttcttcctgaag
agcgtggagaatgcacccctggccaagcggcggaagcagaagctgcggagcgccaccgcc
tcccgccggggctcccctgcaccagccaacccgggccgagcccccgtcgcctccaaaggg
gccccccgccgagccaacggccccctgcccccctcctaa

KEGG   Homo sapiens (human): 9252Help
Entry
9252              CDS       T01001                                 

Gene name
RPS6KA5, MSK1, MSPK1, RLPK
Definition
(RefSeq) ribosomal protein S6 kinase A5
  KO
K04445  ribosomal protein S6 kinase alpha-5 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04713  Circadian entrainment
hsa04722  Neurotrophin signaling pathway
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05219  Bladder cancer
Network
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00077  HRAS-overexpression to RAS-ERK signaling pathway
N00078  Mutation-activated HRAS to RAS-ERK signaling pathway
N00444  TNF-p38 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    9252 (RPS6KA5)
   04668 TNF signaling pathway
    9252 (RPS6KA5)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    9252 (RPS6KA5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    9252 (RPS6KA5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    9252 (RPS6KA5)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    9252 (RPS6KA5)
   05206 MicroRNAs in cancer
    9252 (RPS6KA5)
   05219 Bladder cancer
    9252 (RPS6KA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9252 (RPS6KA5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9252 (RPS6KA5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   9252 (RPS6KA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH Pkinase_C Haspin_kinase FTA2 RIO1 Choline_kinase SR-25
Motif
Other DBs
NCBI-GeneID: 9252
NCBI-ProteinID: NP_004746
OMIM: 603607
HGNC: 10434
Ensembl: ENSG00000100784
Vega: OTTHUMG00000171055
Pharos: O75582(Tchem)
UniProt: O75582
Structure
PDB: 

Position
14q32.11
AA seq 802 aa AA seqDB search
MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAY
GKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYA
FQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKL
ENILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWS
LGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQRLLMKDPKK
RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYS
PAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPN
IVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGV
VHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYD
ESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEA
KDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFH
AFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTL
QPSNPADSNNPETLFQFSDSVA
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagggtggcagcagcggcggcgccgcggggaccagcgcggacggcggcgac
ggaggagagcagctcctcactgtcaagcacgagctgcggactgctaatttgacaggacat
gctgagaaggtgggaatagaaaattttgagctcctgaaggtcctaggaactggagcttat
ggaaaagtatttctagttcgtaaaataagtggccatgatactggaaagctgtatgccatg
aaagttttgaaaaaggcaacaatcgttcaaaaggccaaaaccacagagcatacaaggaca
gaacgacaagtcctggaacacattaggcagtcgccatttttggtaacattacattatgct
ttccagacagaaaccaaacttcatctcattttagattatataaatggtggtgaacttttt
actcatctttctcaaagagagcgtttcacagagcatgaggtgcagatttatgttggagag
attgtgcttgccctcgaacatctccacaagttggggattatatatcgtgatattaagctt
gagaatattctacttgattctaatggccatgtggtgctgacagattttggtctgagtaag
gagtttgtggctgatgaaactgaaagagcatattccttttgtggaactattgaatacatg
gcaccagatattgtcagagggggagattcaggacatgacaaggcagttgactggtggagt
ttgggtgttctaatgtatgaattactaactggagcatctcctttcactgttgatggagaa
aaaaattcccaagctgagatatctaggagaatattaaaaagtgagcctccatatccccaa
gaaatgagtgctttagcgaaagacctaattcagcgtcttttgatgaaagatcccaagaag
agattgggatgtggtccacgtgatgcagatgaaatcaaagaacatctcttctttcagaaa
ataaattgggatgatttagccgccaaaaaagtgcctgcaccatttaagccagtcattcga
gatgaattagatgtgagtaactttgcagaagagttcacagaaatggatcccacttattct
cccgcagccctgccccagagttctgagaagctgtttcagggctattcctttgttgctcct
tccatcctattcaagcgtaatgcagctgtcatagaccctcttcagtttcacatgggagtt
gaacgtcctggagtgacaaatgttgccaggagtgcaatgatgaaggactctccattctat
caacactatgacctagatttgaaggacaaacccctgggagaaggtagtttttcaatttgt
cgaaagtgtgtgcataaaaaaagtaaccaagcttttgcagtcaaaataatcagcaaaagg
atggaagccaatactcaaaaggaaataacagctctgaaactctgtgaaggacaccccaat
attgtgaagttgcatgaagtttttcatgatcagcttcacacgtttctagtgatggaactt
ctgaatggaggagaactgtttgagcgcattaagaaaaagaagcacttcagtgagacggaa
gccagctacatcatgaggaagcttgtttcagctgtaagccacatgcatgatgttggagtg
gtgcacagggatctgaaacctgagaatttattgttcaccgatgaaaatgacaatttggaa
attaaaataattgattttggatttgcacggctaaagccaccggataatcagcccctgaag
actccatgcttcacccttcattatgccgccccagagctcttgaatcagaacggctacgat
gagtcctgtgacctgtggagcttgggcgtcattttgtacacaatgttgtcaggacaggtt
cccttccaatctcatgaccgaagtttgacgtgtaccagcgcggtggaaatcatgaagaaa
attaaaaagggagatttctcctttgaaggagaagcctggaagaatgtatcccaagaggct
aaagatttgatccaaggacttctcacagtagatccaaacaaaaggcttaaaatgtctggc
ttgaggtacaatgaatggctacaagatggaagtcagctgtcctccaatcctctgatgact
ccggatattctaggatcttccggagctgccgtgcatacctgtgtgaaagcaaccttccac
gcctttaacaaatacaagagagaggggttttgccttcagaatgttgataaggcccctttg
gctaagagaagaaaaatgaaaaagactagcaccagtaccgagacgcgcagcagttccagt
gagagttcccattcttcttcctctcattctcacggtaaaactacacccaccaagacactg
cagcccagcaatcctgccgacagcaataacccggagaccctcttccagttctcggactca
gtagcttag

DBGET integrated database retrieval system