KEGG   Homo sapiens (human): 89866
Entry
89866             CDS       T01001                                 

Gene name
SEC16B, LZTR2, PGPR-p117, RGPR, RGPR-p117, SEC16S
Definition
(RefSeq) SEC16 homolog B, endoplasmic reticulum export factor
  KO
K20353  COPII coat assembly protein SEC16
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    89866 (SEC16B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    89866 (SEC16B)
SSDB
Motif
Pfam: Sec16_C Sec16 E7
Other DBs
NCBI-GeneID: 89866
NCBI-ProteinID: NP_149118
OMIM: 612855
HGNC: 30301
Ensembl: ENSG00000120341 ENSG00000254154
Vega: OTTHUMG00000167206
Pharos: Q96JE7(Tbio)
UniProt: Q96JE7
Position
1q25.2
AA seq 1060 aa
MELWAPQRLPQTRGKATAPSKDPDRGFRRDGHHRPVPHSWHNGERFHQWQDNRGSPQPQQ
EPRADHQQQPHYASRPGDWHQPVSGVDYYEGGYRNQLYSRPGYENSYQSYQSPTMREEYA
YGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSN
SRNPCKDSPASNSGQEWPGELFPGSLLAEAQKNKPSLASESNLLQQRESGLSSSSYELSQ
YIRDAPERDDPPASAAWSPVQADVSSAGPKAPMKFYIPHVPVSFGPGGQLVHVGPSSPTD
GQAALVELHSMEVILNDSEEQEEMRSFSGPLIREDVHKVDIMTFCQQKAAQSCKSETLGS
RDSALLWQLLVLLCRQNGSMVGSDIAELLMQDCKKLEKYKRQPPVANLINLTDEDWPVLS
SGTPNLLTGEIPPSVETPAQIVEKFTRLLYYGRKKEALEWAMKNHLWGHALFLSSKMDPQ
TYSWVMSGFTSTLALNDPLQTLFQLMSGRIPQAATCCGEKQWGDWRPHLAVILSNQAGDP
ELYQRAIVAIGDTLAGKGLVEAAHFCYLMAHVPFGHYTVKTDHLVLLGSSHSQEFLKFAT
TEAIQRTEIFEYCQMLGRPKSFIPSFQVYKLLYASRLADYGLVSQALHYCEAIGAAVLSQ
GESSHPVLLVELIKLAEKLKLSDPLVLERRSGDRDLEPDWLAQLRRQLEQKVAGDIGDPH
PTRSDISGAGGTTTENTFYQDFSGCQGYSEAPGYRSALWLTPEQTCLLQPSPQQPFPLQP
GSYPAGGGAGQTGTPRPFYSVPETHLPGTGSSVAVTEATGGTVWEEMLQTHLGPGENTVS
QETSQPPDGQEVISKPQTPLAARPRSISESSASSAKEDEKESSDEADKNSPRNTAQRGKL
GDGKEHTKSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLSLTP
SPESPPLPDVSAFSRGRGGGEGRGSASSGGAAAGAGVGGLSGPESVSFELCSNPGVLLPP
PALKGAVPLYNPSQVPQLPTATSLNRPNRLAQRRYPTQPC
NT seq 3183 nt   +upstreamnt  +downstreamnt
atggaactttgggctccccagaggctgccccagacacgagggaaggccacagcaccctca
aaggatccagaccgagggtttcggagagatggacatcatcggcctgtccctcactcttgg
cacaatggagagaggtttcaccaatggcaagacaaccgtgggagcccccagccacagcag
gagcccagggcagaccatcagcagcagccccattatgcatccaggccaggggactggcat
cagcctgtgtctggagttgactattacgaaggtggttatcgcaatcagttgtattcaagg
ccaggttatgagaattcatatcagagctatcagtctcccacaatgagggaggaatatgct
tatggaagttattactatcatggacacccacagtggctgcaggaagaaagagtgccaagg
caacggagtccttatatctggcacgaagattaccgagagcaaaagtaccttgatgaacat
cattatgaaaaccagcacagtccatttggaacaaatagtgagacccacttccaatctaac
agtaggaacccttgtaaagacagccctgcttccaactctggacaggagtggccgggggag
ctgtttccagggagcctgcttgctgaggcccagaaaaataagccatcattggctagtgag
tccaaccttctccagcagcgtgagtctggtctcagctccagcagctatgagctcagtcag
tacatcagagatgccccggagcgggatgatcccccagcttcagcagcttggagtccagtt
caggctgatgtctcctcagctggtcccaaagcacccatgaagttctacatccctcatgtt
cctgtgagtttcgggccaggaggtcagctggtgcatgtaggtcccagctctcccactgac
gggcaagcagcccttgttgaactgcacagcatggaggttattcttaatgattccgaagag
caagaggagatgagaagtttctcaggacccttgattagggaagatgtacataaggtggat
attatgacgttttgccagcagaaagcagctcagagctgcaaatctgagacactggggagc
agagactcagctctactgtggcagctcttggttctcctttgtcgccagaatgggtccatg
gtggggtctgacatcgctgagctgctaatgcaagactgcaagaagctggagaagtacaag
cggcagccccctgtggccaacctcatcaacctgaccgatgaggactggccagtgctgagc
tctgggaccccgaacctgctcacgggagagatcccccccagtgtggagacacctgcgcag
atcgtggagaaattcactaggctgctctactatggaaggaagaaggaagccttggagtgg
gccatgaagaaccacttgtggggccatgctttgttcctgtccagcaagatggacccacag
acctacagctgggtcatgagtggcttcaccagcacgctggcgctcaatgacccactgcag
accctcttccagctcatgtcggggaggattccacaggcagccacgtgttgtggagaaaag
cagtggggagactggaggcctcacttggctgtgattctgtcgaatcaggctggggaccca
gagctgtatcagcgtgcgattgttgccattggggacaccctggctgggaaggggcttgtg
gaggcagctcacttctgctatctcatggctcacgtgccctttggccactacaccgtgaag
acagaccatctggtcttgctgggcagcagccacagtcaagagtttttgaaatttgcaaca
actgaggcaatccagaggacggaaatcttcgagtactgtcagatgctgggccgccccaaa
tccttcatcccttctttccaggtgtataagctcctttatgcttcccgtctggcagattat
ggcctcgtgtcccaggctttgcattactgcgaagccattggtgcagctgtcttgagccag
ggagagagcagtcaccctgtgctattagtggaactcatcaagctagcagagaaactgaag
ctgtcagatcctctggttttagaaagacgcagtggagacagggacctggagccagattgg
ctagcgcaacttcggaggcagctggagcaaaaggtagcaggagacattggggatcctcat
cctactcgctcagatatttcgggagccggaggaacaacaacagaaaacactttctaccag
gacttttctggatgtcaaggctactctgaagcccctgggtaccgctcagctctgtggctg
acacctgagcagacctgcctgctccagcccagcccacagcagccctttcccctccagccg
ggctcctacccagcaggagggggtgcagggcagacagggacaccgaggcctttttactca
gttcctgagacccatctaccagggactggcagcagcgtggcagtgacagaggccactgga
ggaacagtctgggaggaaatgctgcagacacacctgggccctggagagaacacagtgtct
caagaaacttcccagcctcctgatggccaagaggtcatttccaaaccacagacaccattg
gctgctagaccacgaagtatttctgagagttccgccagttcagccaaggaggatgagaag
gagtcctctgatgaggctgataaaaactctccccgaaatactgcccagagaggcaagctc
ggagatgggaaggagcatacaaagagctcagggtttggctggttcagctggtttcgatcg
aagcccaccaagaacgcatcccccgctggagacgaggactcctcagacagccctgactct
gaggagacccccagagcatcttctccccaccaggctggcctgggcctctcactgacacct
tcccctgagtccccacctctgccggatgttagtgccttctccaggggcagaggtgggggt
gaaggccgaggatccgcatccagcgggggagcagctgcgggcgctggggttggaggcttg
tctggaccagagagtgtttcctttgagctctgctccaaccctggtgttcttcttcctcca
cctgccttaaaaggggctgttcctctttacaacccatctcaggtgcctcagctgcccacg
gccactagcctgaatcggccaaatcgcctagctcagcgtcgctatcccacccagccatgc
tga

DBGET integrated database retrieval system