KEGG   Homo sapiens (human): 89869Help
Entry
89869             CDS       T01001                                 

Gene name
PLCZ1, NYD-SP27, PLC-zeta-1, PLCzeta, SPGF17
Definition
(RefSeq) phospholipase C zeta 1
  KO
K05861  phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04114  Oocyte meiosis
hsa04919  Thyroid hormone signaling pathway
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    89869 (PLCZ1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    89869 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    89869 (PLCZ1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    89869 (PLCZ1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    89869 (PLCZ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    89869 (PLCZ1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     89869 (PLCZ1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    89869 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like C2 EF-hand_10 EF-hand_7 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 89869
NCBI-ProteinID: NP_149114
OMIM: 608075
HGNC: 19218
Ensembl: ENSG00000139151
Vega: OTTHUMG00000168937
Pharos: Q86YW0(Tbio)
UniProt: Q86YW0 A0A140VJR9
Position
12p12.3
AA seq 608 aa AA seqDB search
MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEF
RAIYRIITHREEIIEIFNTYSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPI
EEVRKAHQMSLEGFTRYMDSRECLLFKNECRKVYQDMTHPLNDYFISSSHNTYLVSDQLL
GPSDLWGYVSALVKGCRCLEIDCWDGAQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
DYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDFPDTLPSPEALKFKILVKNKK
IGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKLKIALALSDLVIYTKAEK
FKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNFNP
QEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGM
PITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETF
TFIIHVPELALIRFVVEGQGLIAGNEFLGQYTLPLLCMNKGYRRIPLFSRMGESLEPASL
FVYVWYVR
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgagatggtttttgtcaaagattcaggatgacttcagaggtggaaaaattaac
ctagaaaaaactcagaggttacttgaaaaattagatattcggtgcagttatattcatgtg
aaacagatttttaaggacaatgacaggctgaaacaaggaagaatcaccatagaagaattt
agagcaatttatcgaattatcacgcacagagaagaaattattgagattttcaacacatat
tctgaaaaccggaaaattcttttagcaagtaatctggctcaatttctgacacaagaacaa
tatgcagctgagatgagtaaagctattgcttttgagatcattcagaaatacgagcctatc
gaagaagttaggaaagcacaccaaatgtcattagaaggttttacaagatacatggattca
cgtgaatgtctactgtttaaaaatgaatgtagaaaagtttatcaagatatgactcatcca
ttaaatgattattttatttcatcttcacataacacatatttggtatctgatcaattattg
ggaccaagtgacctttggggatatgtaagtgcccttgtgaaaggatgccgttgtttggag
attgactgctgggatggagcacaaaatgaacctgttgtatatcatggctacacactcaca
agcaaacttctgtttaaaactgttatccaagctatacacaagtatgcattcatgacatct
gactacccagtggtgctctctttagaaaatcactgctccactgcccaacaagaagtaatg
gcagacaatttgcaggctacttttggagagtccttgctttctgatatgcttgatgatttt
cctgatactctaccatcaccagaggcactaaaattcaaaatattagttaaaaataagaaa
ataggaaccttaaaggaaacccatgaaagaaaaggttctgataagcgtggagacaatcaa
gacaaggaaacaggggtaaaaaagttacctggagtaatgcttttcaagaaaaagaagacc
aggaagctaaaaattgctctggccttatctgatcttgtcatttatacgaaagctgagaaa
ttcaaaagctttcaacattcaagattatatcagcaatttaatgaaaataattctattggg
gagacacaagcccgaaaactttcaaaattgcgagtccatgagtttatttttcacaccagg
aagttcattaccagaatatatcccaaagcaacaagagcagactcttctaattttaatccc
caagaattttggaatataggttgtcaaatggtggctttaaatttccagacccctggtctg
cccatggatctgcaaaatgggaaatttttggataatggtggttctggatatattttgaaa
ccacatttcttaagagagagtaaatcatactttaacccaagtaacataaaagagggtatg
ccaattacacttacaataaggctcatcagtggtatccagttgcctcttactcattcatca
tctaacaaaggtgattcattagtaattatagaagtttttggtgttccaaatgatcaaatg
aagcagcagactcgtgtaattaaaaaaaatgcttttagtccaagatggaatgaaacattc
acatttattattcatgtcccagaattggcattgatacgttttgttgttgaaggtcaaggt
ttaatagcaggaaatgaatttcttgggcaatatactttgccacttctatgcatgaacaaa
ggttatcgtcgtattcctctgttttccagaatgggtgagagccttgagcctgcttcactg
tttgtttatgtttggtacgtcagataa

DBGET integrated database retrieval system