KEGG   Homo sapiens (human): 8987Help
Entry
8987              CDS       T01001                                 

Gene name
STBD1, GENEX3414, GENX-3414
Definition
(RefSeq) starch binding domain 1
  KO
K22267  starch-binding domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8987 (STBD1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Glycophagy associated proteins
    8987 (STBD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBM_20
Motif
Other DBs
NCBI-GeneID: 8987
NCBI-ProteinID: NP_003934
OMIM: 607406
HGNC: 24854
Ensembl: ENSG00000118804
Vega: OTTHUMG00000130109
Pharos: O95210(Tbio)
UniProt: O95210
Position
4q21.1
AA seq 358 aa AA seqDB search
MGAVWSALLVGGGLAGALFVWLLRGGPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGL
SPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRLQNPSREVCDNSREHVPSGQF
PDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLK
NRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLV
EARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLH
YNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgtctggtccgccctgctggttggagggggtctggccggagcacttttcgtt
tggctgctgcggggcggccctggcgacaccgggaaggacggggatgcggagcaggagaaa
gacgcccctcttgggggagctgcgattccgggaggccatcagagtggcagcagcggactg
agccctggaccttccgggcaggagctggtcaccaaaccagagcatcttcaagaaagcaat
ggacatttgatttctaagaccaaagaccttggtaaactgcaagcagcatcatggagattg
cagaatccttccagggaagtctgtgacaattcaagagaacatgttccttctggacagttt
ccagacacagaagctccagctacctctgagaccagtaactctaggagttactctgaagtt
tcaagaaatgaaagccttgaatctcctatgggagaatggggattccaaaaaggacaagag
atatctgctaaagcagctacatgttttgcagagaagttgccttctagcaacctgctcaag
aacagagctaaagaagaaatgagcctctctgatttgaacagtcaggaccgggttgaccac
gaggagtgggaaatggtgcctaggcactcatcttggggggatgttggtgtgggtggcagt
cttaaggctccagtgttaaacctaaaccagggaatggacaatggaagaagcactttggtg
gaagcaagaggtcagcaagtgcatgggaaaatggaaagggtagcagtgatgcctgcaggg
tctcagcaagttagtgtcaggttccaggtccattatgtcacaagcactgatgtgcaattc
attgcagtaactggagaccatgagtgtcttgggagatggaacacttacatcccactccac
tataacaaggatgggttctggtctcattccattttcctgcctgcagatacagtggtggag
tggaagtttgtgttggtagagaatgggggagttacccgctgggaagaatgcagcaataga
ttcctagaaactggccatgaggataaagtggttcacgcatggtgggggattcactga

DBGET integrated database retrieval system