KEGG   Homo sapiens (human): 89874Help
Entry
89874             CDS       T01001                                 

Gene name
SLC25A21, ODC, ODC1
Definition
(RefSeq) solute carrier family 25 member 21
  KO
K15110  solute carrier family 25 (mitochondrial 2-oxodicarboxylate transporter), member 21
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    89874 (SLC25A21)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   89874 (SLC25A21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 89874
NCBI-ProteinID: NP_085134
OMIM: 607571
HGNC: 14411
Ensembl: ENSG00000183032
Vega: OTTHUMG00000140250
Pharos: Q9BQT8(Tbio)
UniProt: Q9BQT8
Position
14q13.3
AA seq 299 aa AA seqDB search
MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSF
RMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSG
LTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHG
VFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQP
VPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaagcctgaagtcagcttagtgcgcgaggcttctcggcagatcgtggccggt
ggttctgcaggtcttgtagaaatttgcctgatgcaccccctagatgtggtgaaaaccagg
tttcagattcagagatgtgcaaccgatccaaacagttataaaagcttggtagacagcttt
cgaatgattttccaaatggaagggttatttggtttttacaagggaattctgccacctatc
ttggctgaaaccccaaaaagagcagtgaagtttttcacctttgagcagtacaagaaattg
ctgggatatgtgtcactgtcaccagcattgacattcgccattgctggattgggatctgga
ctaacagaagccattgtagttaacccttttgaggtagtaaaagttggcttgcaagcaaat
cggaacacatttgcagagcaaccatccactgtgggttatgcaagacaaatcattaagaag
gaaggctggggactccagggcctcaacaaaggattaactgcaactttgggacgacatgga
gttttcaacatggtttattttggcttctactacaatgtcaaaaacatgattcctgtcaat
aaggatccaatcttggagttttggagaaaatttgggattggtcttctctcggggacaata
gcctcagtcattaacatcccttttgatgttgccaaaagtaggattcaagggcctcaacca
gttcctggagagatcaagtacagaacctgttttaaaacaatggcaacagtctatcaggaa
gaagggattttagctttgtacaaaggcctgcttcccaagattatgagacttggaccaggt
ggtgcagtgatgctgctggtttatgaatacacctattcatggcttcaagagaactggtga

DBGET integrated database retrieval system