KEGG   Homo sapiens (human): 89882Help
Entry
89882             CDS       T01001                                 

Gene name
TPD52L3, D55, NYDSP25, hD55
Definition
(RefSeq) TPD52 like 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TPD52 DUF1192 DUF3811
Motif
Other DBs
NCBI-GeneID: 89882
NCBI-ProteinID: NP_277051
OMIM: 617567
HGNC: 23382
Ensembl: ENSG00000170777
Vega: OTTHUMG00000019518
Pharos: Q96J77(Tdark)
UniProt: Q96J77
Position
9p24.1
AA seq 140 aa AA seqDB search
MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGEL
KRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATFRS
FEGLMGTIKSKVSGGKRAWP
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgccacatgccaggacagagacctctgtgggcacatatgaatcccactcgacttctgaa
ctggaggatctgacagagcccgagcaaagagagctcaaaaccaaactcactaaattggag
gctgaaattgtaaccctacgccacgtactagcagccaaagagagacgctgtggggaactc
aagaggaagttaggcctcaccgccttggtagggctgagacagaatctgtccaagagctgg
cttgatgttcaggtctccaacacctatgtgaaacagaagacatcagctgctctgtccacc
atgggcactctcatctgcaggaagcttggaggcgtgaagaagtcggccacattcagatct
tttgaaggtctgatggggacaatcaagtccaaagtctcagggggcaaaagagcttggccc
tga

DBGET integrated database retrieval system